1IRU


Conserved Protein Domain Family
proteasome_alpha_type_4

?
cd03752: proteasome_alpha_type_4 
Click on image for an interactive view with Cn3D
proteasome_alpha_type_4. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Statistics
?
PSSM-Id: 239721
View PSSM: cd03752
Aligned: 19 rows
Threshold Bit Score: 370.139
Threshold Setting Gi: 7576250
Created: 12-Jun-2006
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
active sitealpha subunit
Conserved site includes 5 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                  #               # #                   #            
1IRU_Q      3 RRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLdev------ffsEKIYKLNEDMACSV 76  cattle
Q09682      3 RSYDSRTTIFSPEGRLYQVEYALEAINHAGVALGIVAKDGIVLAAEKKVTSKLLeqe------esaEKLYHIGDNMLCAV 76  fission yeast
CAB87991    2 SRFDSRTTLFSQDGRLLQVEYAIKAVTIAAPCLAILAQDGIVFVAQKKLPSKLSdqq-------tsEKIYKIDSHIVCAV 74  Giardia intestinalis
AAG28528    3 SRYDSRTTTFSPEGRLYQVEYAEEAISQAGTIIGILTTGGVVLDAERGQQHGLFdtenmedinisgEKVYKISNHLGCSV 82  Trypanosoma brucei
Q9N599      3 RRYDSRTTIFSPEGRLYQVEYAMEAISHAGTCLGILSSEGIVVAAERKNVHKLLdds------vmtEKVYRLSDNISCTV 76  Caenorhabditis ele...
EAA21790    3 RRYDSRTTTFSPEGRLYQVEYALEAINNASITIGIITNDGVILGADKVFISKLInka------nnfEKIYKIDDHIFCGV 76  Plasmodium yoelii ...
CAD52659    3 RRYDSRTTTFSPEGRLYQVEYALEAINNASITIGLITKDGVILGADKVFISKLIdka------nnyEKIYKIDKHIFCGV 76  Plasmodium falcipa...
XP_325797   3 RRYDSRTTIFSPEGRLYQVEYALEAISHAGTAIGILAKDGIVLAAERKVTSKLLeqd------tsaEKLYILNDNMICAV 76  Neurospora crassa
XP_625633  13 RRYDSRTTTFSPEGRLYQVEYALEAINNAAPTVGILCKEGVILGADKAIVSKLLdqg------kslEKIYTIDRHIIAAV 86  Cryptosporidium pa...
XP_758193   3 RRYDSRTTTFSPEGRLYQVEYAMEAISHAGTVIGILAKDGIVLAAEKKVTSKLLeqd------qssEKIFAVSDNVMAGV 76  Ustilago maydis 521
Feature 1                                                                                     
1IRU_Q     77 AGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNY 156 cattle
Q09682     77 AGLTADANILINYARRVGQQYLQTFNEEMPCEQLVRRVCDLKQGYTQYGGLRPFGVSFLYAGWDHIRGYQLFQSNPSGNY 156 fission yeast
CAB87991   75 SGLTSDANILIDEARTYSQKWLAVYDEPIPVEVLVQYISDVKQNYTHHGGLRPYGVSFLFGGWDAHLGFQLYQTDPSGNY 154 Giardia intestinalis
AAG28528   83 AGVTSDAYALINYARLSAARHFYSFQEPIAAEDLCRMVCDEKQLYTQYGGVRPFGVSFLFAGWDRHYGYQLYHTDASGNY 162 Trypanosoma brucei
Q9N599     77 AGITADANILINHLRWWAASYRNSYGEEMPVEQLVQNLCNEKQRYTQIGGKRPFGVSLLYIGWDKHYGYQLYQSDPSGNY 156 Caenorhabditis ele...
EAA21790   77 AGLNADANILINQSRLYAQRYLYNYNDVEPVAQLVVQICDIKQSYTQYGGLRPYGVSFLIAGYDTKEGYQLYHTDPSGNY 156 Plasmodium yoelii ...
CAD52659   77 AGLNADANILINQSRLYAQRYLYNYNEVQPVSQLVVQICDIKQSYTQYGGLRPYGVSFLIGGYDTKDGYQLYHTDPSGNY 156 Plasmodium falcipa...
XP_325797  77 AGMTADANILINYARQAAQRYLLTYNEDIPCEQLVRRLCDLKQGYTQHGGLRPFGVSFIYAGWDPQRQFQLYLSNPSGNY 156 Neurospora crassa
XP_625633  87 AGLTADANILIAQARIDSQRYQYTYGEEQPVEQLVTQICDRKQSYTQFGGLRPFGVSFLFAGYDKNYGYQLYQSDPSGNF 166 Cryptosporidium pa...
XP_758193  77 AGYTADANSLVNFARNAAQQYLASYDDDMPVEQLAQRLCDYKQGYTQFGGLRPFGVSILYAGYDDHHHFQLYHSDPSGNY 156 Ustilago maydis 521
Feature 1              #                                                    
1IRU_Q    157 GGWKATCIGNNSAAAVSMLKQDYkeg--emtLKSALALAIKVLNKTMDvsklsaeKVEIATL 216 cattle
Q09682    157 GSWQANSIGGNSTSVQSLMRQEYkdd---inLDEASAMAVKFLSKTLDsnsltheKIEFATI 215 fission yeast
CAB87991  155 SAWVATSIGGSAPEIASALKQNIadssqkilLKEAQQYAVSALIKTTDitkvssdKMEILTV 216 Giardia intestinalis
AAG28528  163 SAWRAYAVGQNDQVAQSLLKRDWkpe---ltLEEGIVLCLRVLGKTMDavkltpeRLEVAVL 221 Trypanosoma brucei
Q9N599    157 TGWKATCIGSNHQAAVTLLKQEYks----pnLEEAKQLAIKVLWKTLDvkl-aseKVEMAVL 213 Caenorhabditis elegans
EAA21790  157 SGWFATAIGTNNLTASSILKQEWkkd---mtLQEGLLLAIKTLAKSTDseipkceKIELAYL 215 Plasmodium yoelii yoelii
CAD52659  157 SGWFATAIGTNNLTASSVLKQEWknd---mtLEEGLLLALKTLAKSTDteipkseKIELAYL 215 Plasmodium falciparum 3D7
XP_325797 157 GGWKATSAGANNASAQSLLKQDYked---ctLKEACAMAVKVLSKTMDstklspeKIEFATV 215 Neurospora crassa
XP_625633 167 SGWKATAIGQNNQTATSLLKQEWned---ltLEQGLHLVAKVLTKTMDttsptadKFEFSIL 225 Cryptosporidium parvum Iowa II
XP_758193 157 SGWKATCIGNNNGTATSLLKQDYkdd---lgIQDAMAMAVKILSKTMDstsldseKLEFATL 215 Ustilago maydis 521

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap