1IRU


Conserved Protein Domain Family
proteasome_alpha_type_1

?
cd03749: proteasome_alpha_type_1 
Click on image for an interactive view with Cn3D
proteasome_alpha_type_1. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Statistics
?
PSSM-Id: 239718
View PSSM: cd03749
Aligned: 21 rows
Threshold Bit Score: 332.718
Threshold Setting Gi: 29247195
Created: 12-Jun-2006
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
active sitealpha subunit
Conserved site includes 5 residues -Click on image for an interactive view with Cn3D
Feature 1:active site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                #               # #          #                       
1IRU_T      6 YDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLC 85  cattle
P52428      6 YDTDVTTWSPAGRLFQVEYAMEAVKQGSACVGLRSRTHAVLAAANKAASELSSHQRKVFRVADHAGVALAGLTADGRVLS 85  rice
AAC23597    6 YDTDVVTWSPQGRVFQIEYAMEAVKQGTAVVGARNDEIVVLACIKRSTSRLAGYQKKLYKIDNHIGVAVSGITADAKVIC 85  Cryptosporidium pa...
AAC32062    6 YDTDVTTWSPTGRLFQVEYAMEAVKQGSAAIGLRSRSHVVLACVNKAQSELSSHQRKIFKVDDHIGVAIAGLTADGRVLS 85  thale cress
NP_702605   6 YDTDNIIYSPEGRLYQVEYASEAIKQGTCAVAIKSKDYVVVSGLKKCISKLSFPQEKIFKIDDYIGISMSGITSDAKVLT 85  Plasmodium falcipa...
EAL22803    6 YDSDNTTFSPQGKLFQVEYALEAVKQGSAAIGLRSNTHAVLLTLKRSTGELATYQKKLIRIDDHVGVAIAGLTSDARVLS 85  Cryptococcus neofo...
XP_653086   6 YDSDNITWSPQGRLFQIEYATEAVKQGSAVVGVKSKTHAVVATFNRQTDELGAYQKKIFEIDDHIGVAISGFCADARVIT 85  Entamoeba histolyt...
XP_765495   6 YDTDCITWSPQGRLFQVEYAMESVKQGTCCVGIKSNTHLVLCALKRKISKLAQVQDKLYKVGEYIGVAMSGITSDAKMII 85  Theileria parva st...
EAR89504    8 YDTDCSTWSTNGKLLQVDYATKAIDQGSITIGLRSQKFAVLVAQKRSNSKLSGYQEKIFQVDDKIGMGVAGITADARVIC 87  Tetrahymena thermo...
O14250      6 YDGDATTWSPQGRLHQVEYALEAIKQGSATVGLVSKTHAVLVALKRNAEELSSYQKKLIRIDDHIGIAIAGLAPDARVLS 85  fission yeast
Feature 1                                                                                   # 
1IRU_T     86 NFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDdm-gPHIFQTCPSANYFDCRAMSIGAR 164 cattle
P52428     86 RFLRSECINHAFVYDAPLPVSRLALRLADKAQVCTQRSWKRPYGVGLLVAGLDes-gAHLYYNCPSGNYFEYQAFAIGSR 164 rice
AAC23597   86 NYLRSECLNYSFTYDSPIPLNTLVNRLVLKSQVNTQEYGRRPFGVGLLLAGFDes-gPHLFETCPSGNCFEYYSIAIGSR 164 Cryptosporidium pa...
AAC32062   86 RYMRSESINHSFTYESPLPVGRLVVHLADKAQVCTQRSWKRPYGVGLLVGGLDes-gAHLYYNCPSGNYFEYQAFAIGSR 164 thale cress
NP_702605  86 KFMQNECLSHKFLYNENINIESLVRSVADKYQKNTQKSSKRAFGVGLMIAAYHn--ePCIFETRPNGSYFEYDALSFGAR 163 Plasmodium falcipa...
EAL22803   86 NYMRQKAMQSRMTYGRATPVARLVQSIADRAQTNTQEYGRRPYGVGFLVIGKDet-gPHLFEFSPAGTAFEYYAHSIGAR 164 Cryptococcus neofo...
XP_653086  86 SQMRSECIDYSYVYGTPHPVEKLVKHVSDNAQVNTQKYGLRPYGVGLLVIGYDt--kPRLFETSPSGLYYSYKAQAIGAR 163 Entamoeba histolyt...
XP_765495  86 SYMRNECLSNRFLYGCDITASQLVSLVSEKSQANTQVSSKRPFGVGLLVAGYDettgLHLFETCPSGNVVEFNATAFGAR 165 Theileria parva st...
EAR89504   88 KYMRTECLNHKYVYGSQHPAQRLVIKISEKSQHKTQTYGKRPYGVGTLIIAQEsd-gPKLFQTLPSGDFYEFYGQSIGSR 166 Tetrahymena thermo...
O14250     86 NYMKQEALSSKTLFTRPIPVRRLMSKVAEKAQINTQEYGRRPYGVGFLVIGYDes-gPHLLEFQPSGLVLEYLGTSMGSR 164 fission yeast
Feature 1                                                           
1IRU_T    165 SQSARTYLERHMSEFmec-nlNELVKHGLRALRETLpaeqd-lttkNVSIGIVG 216 cattle
P52428    165 SQAAKTFLERRFEGYndy-tpEQLIKDALSAIKETLqgek--ltssNCTVAIVG 215 rice
AAC23597  165 SQASKTYLEKHFKEFanc-skDQLILHTLRALRSSLsseqe-mnqeNVDVAILG 216 Cryptosporidium parvum
AAC32062  165 SQAAKTYLERRFESFgds-srEDLIKDAILAVRETLqget--lkssLCTVAILG 215 thale cress
NP_702605 164 SHASKTYLEKNLHLFeec-slEELILHCLKALKCSLssese-ltisNTALAVVG 215 Plasmodium falciparum 3D7
EAL22803  165 SQSAKTYLEKNYHLFpna-slEELINHGLSALHDTLqqdkh-lsslNTSIAIIG 216 Cryptococcus neoformans var. neoformans B-3501A
XP_653086 164 SQSCRTYLEKHFESFkel-deEQLIKQAILALRESLtttndklsvlNCSVAIVG 216 Entamoeba histolytica HM-1:IMSS
XP_765495 166 CQSAKTYLERKIVNFses-dlNGLIYHAIKALKTTIpndge-fdvdVISVGVVG 217 Theileria parva strain Muguga
EAR89504  167 SQAAKTYLENNLELFkdcndlNTLILHGLSALKKANqgeee-llpqSVDIAFVG 219 Tetrahymena thermophila SB210
O14250    165 SQSARTYIERNLDTFpds-srEELILSALRALRDTLskdqe-lteeNVSISVIG 216 fission yeast

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap