Conserved Protein Domain Family
SOCS_WSB1_SWIP1

?
cd03746: SOCS_WSB1_SWIP1 
SOCS (suppressors of cytokine signaling) box of WSB1/SWiP1-like proteins. This subfamily contains WSB-1 (SOCS-box-containing WD-40 protein), part of an E3 ubiquitin ligase for the thyroid-hormone-activating type 2 iodothyronine deiodinase (D2) and SWiP-1 (SOCS box and WD-repeats in Protein), a WD40-containing protein that is expressed in embryonic structures of chickens and regulated by Sonic Hedgehog (Shh). The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.
Statistics
?
PSSM-Id: 239715
Aligned: 6 rows
Threshold Bit Score: 84.8629
Threshold Setting Gi: 74136113
Created: 2-May-2006
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative
Feature 1:putative elongin B/C interaction [polypeptide binding site]
Evidence:
  • Comment:based on the homology to the human SOC2 complex

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1         ######     #      #     #    #         
XP_872331    382 RQVPSLQHLCRMSIRRVMPTQEVQELPVPSKVLEFLSYRV 421 cattle
AAH64858     382 KYVSSLQHLCRMAIRRVMNTNEVKKLPIPQKIMEFLTYQT 421 western clawed frog
NP_990203    382 RQVSSLQHLCRMAIRRVMPTSQVKNLPTPSKVVEFLCYQI 421 chicken
BAD96296     382 RQVPSLQHLCRMSIRRVMPTQEVQELPIPSKLLEFLSYRI 421 human
AAH54567     383 RSIASLQHLCRMTLRRVMPTQQVYTLPIPFSMQDYLAYKT 422 zebrafish
NP_001027919 387 RSIASLQHLCRMALRRVKTTQQVEALPVPMPLRDFLTYRV 426 torafugu
AAH64858     382 KYVSSLQHLCRMAIRRVMNTNEVKKLPIPQKIMEFLTYQT 421 western clawed frog
NP_990203    382 RQVSSLQHLCRMAIRRVMPTSQVKNLPTPSKVVEFLCYQI 421 chicken
BAD96296     382 RQVPSLQHLCRMSIRRVMPTQEVQELPIPSKLLEFLSYRI 421 human
AAH54567     383 RSIASLQHLCRMTLRRVMPTQQVYTLPIPFSMQDYLAYKT 422 zebrafish
NP_001027919 387 RSIASLQHLCRMALRRVKTTQQVEALPVPMPLRDFLTYRV 426 torafugu

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap