Conserved Protein Domain Family
SOCS_SOCS7

?
cd03741: SOCS_SOCS7 
SOCS (suppressors of cytokine signaling) box of SOCS7-like proteins. Together with CIS1, the CIS/SOCS family of proteins is characterized by the presence of a C-terminal SOCS box and a central SH2 domain. SOCS7 is important in the functioning of neuronal cells. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.
Statistics
?
PSSM-Id: 239710
Aligned: 9 rows
Threshold Bit Score: 76.6745
Threshold Setting Gi: 55238057
Created: 2-May-2006
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative
Feature 1:putative elongin B/C interaction [polypeptide binding site]
Evidence:
  • Comment:based on the homology to the human SOC2 complex

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1       ######     #       #     #    #                  
XP_612207  573 SNVKSLQHLCRFRIRQL-VRIDHIPDLPLPKPLISYIRKFYYYDPQEEVY 621  cattle
XP_698923  701 SNVKSLQHLCRFCIRQL-VRIDHIQELPLPKPLIVYLRKFYYYDPEEEMY 749  zebrafish
NP_055413  513 SNVKSLQHLCRFRIRQL-VRIDHIPDLPLPKPLISYIRKFYYYDPQEEVY 561  human
AAW25386    43 QVVASLRHLSRFTILSY-IRRDHIDQLPLPRTIINYLMEKQCYIESLYDF 91   Schistosoma japonicum
XP_792866  125 QKARSLQHMCRFVIRRN-VRLDHIDALPLPRRLKDYLREGQYYTPDDIKP 173  purple urchin
NP_523390  978 KHVQSLQHMCRFVILKAvIRKDLIQTLPLPRRLLDYLNYKHCYSEQVESD 1027 fruit fly
XP_397211  721 KQVQSLQHTCRFVILKM-VRRDLIPTLPLPRRLIDYLSTPHYYSEQLAEQ 769  honey bee
XP_973720  589 KQVQSLQHICRFAIHKV-VRRDLIPSLPLPRRMIDYLNTPHYYSEHLIDV 637  red flour beetle
EAA12058    13 KHVQSLQHICRFVIHKTiKRKDLIQALPLPRRVLDYLCYKNCLSERTEVD 62   Anopheles gambiae str. PEST
XP_698923  701 SNVKSLQHLCRFCIRQL-VRIDHIQELPLPKPLIVYLRKFYYYDPEEEMY 749  zebrafish
NP_055413  513 SNVKSLQHLCRFRIRQL-VRIDHIPDLPLPKPLISYIRKFYYYDPQEEVY 561  human
AAW25386    43 QVVASLRHLSRFTILSY-IRRDHIDQLPLPRTIINYLMEKQCYIESLYDF 91   Schistosoma japonicum
XP_792866  125 QKARSLQHMCRFVIRRN-VRLDHIDALPLPRRLKDYLREGQYYTPDDIKP 173  purple urchin
NP_523390  978 KHVQSLQHMCRFVILKAvIRKDLIQTLPLPRRLLDYLNYKHCYSEQVESD 1027 fruit fly
XP_397211  721 KQVQSLQHTCRFVILKM-VRRDLIPTLPLPRRLIDYLSTPHYYSEQLAEQ 769  honey bee
XP_973720  589 KQVQSLQHICRFAIHKV-VRRDLIPSLPLPRRMIDYLNTPHYYSEHLIDV 637  red flour beetle
EAA12058    13 KHVQSLQHICRFVIHKTiKRKDLIQALPLPRRVLDYLCYKNCLSERTEVD 62   Anopheles gambiae str. PEST

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap