Conserved Protein Domain Family
SOCS_SOCS6

?
cd03740: SOCS_SOCS6 
SOCS (suppressors of cytokine signaling) box of SOCS6-like proteins. Together with CIS1, the CIS/SOCS family of proteins is characterized by the presence of a C-terminal SOCS box and a central SH2 domain. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.
Statistics
?
PSSM-Id: 239709
Aligned: 8 rows
Threshold Bit Score: 75.532
Threshold Setting Gi: 91078474
Created: 2-May-2006
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative
Feature 1:putative elongin B/C interaction [polypeptide binding site]
Evidence:
  • Comment:based on the homology to the human SOC2 complex

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1      ######     #      #     #    #          
21450785  495 MQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 535 human
XP_419106 494 MQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 534 chicken
AAH77367  493 MQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 533 African clawed frog
AAH54619  492 MQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 532 zebrafish
BAE06702  366 SQVRTLQYLCRFVIRQYTRIDHIESLPLPNPVKGYLNESYF 406 Ciona intestinalis
XP_968194 256 EEVRSLKHLCKFVIRQYTNMNDIPKLPLPTVLHGYLLEKPY 296 red flour beetle
XP_624532 302 TQVRSLQYLCRFVIRQNTRLDNIHKLPLPKTIKGYIEEAHY 342 honey bee
XP_780887 351 SEVKSLQYLCRFVIRETYPRHHIRHLPLPKKINEYILENQY 391 purple urchin
XP_419106 494 MQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 534 chicken
AAH77367  493 MQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 533 African clawed frog
AAH54619  492 MQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY 532 zebrafish
BAE06702  366 SQVRTLQYLCRFVIRQYTRIDHIESLPLPNPVKGYLNESYF 406 Ciona intestinalis
XP_968194 256 EEVRSLKHLCKFVIRQYTNMNDIPKLPLPTVLHGYLLEKPY 296 red flour beetle
XP_624532 302 TQVRSLQYLCRFVIRQNTRLDNIHKLPLPKTIKGYIEEAHY 342 honey bee
XP_780887 351 SEVKSLQYLCRFVIRETYPRHHIRHLPLPKKINEYILENQY 391 purple urchin

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap