2C9W


Conserved Protein Domain Family
SOCS_SOCS2

?
cd03736: SOCS_SOCS2 
Click on image for an interactive view with Cn3D
SOCS (suppressors of cytokine signaling) box of SOCS2-like proteins. Together with CIS1, the CIS/SOCS family of proteins is characterized by the presence of a C-terminal SOCS box and a central SH2 domain. SOCS2 has recently been shown to regulate neuronal differentiation by controlling expression of a neurogenic transcription factor, Neurogenin-1. SOCS2 binds to GH receptors and inhibits the activation of STAT5b induced by GH. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.
Statistics
?
PSSM-Id: 239705
Aligned: 5 rows
Threshold Bit Score: 79.1218
Threshold Setting Gi: 47209427
Created: 2-May-2006
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
elongin B/C
Conserved site includes 10 residues -Click on image for an interactive view with Cn3D
Feature 1:elongin B/C interaction
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1      ######     #    #     #    #            
2C9W_A    129 TSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV 169 human
XP_691078 158 TATPSLQHLCRIAINKTTRRVQELPLPNRLKDYLTDYTYNV 198 zebrafish
AAH89190  162 TSTPSLQHLCRMTVNKCTNKIDELPLPMRLKEYITEYRYHV 202 African clawed frog
AAR97666  167 TSAPSLQHRCRITINKCTNQIWELPLPTRLKEYLKEYRYQV 207 chicken
CAF95062  126 TATPTLQHLCRITINRVARQIQDLPLPSRLKDYLTEYTYHV 166 Tetraodon nigroviridis
XP_691078 158 TATPSLQHLCRIAINKTTRRVQELPLPNRLKDYLTDYTYNV 198 zebrafish
AAH89190  162 TSTPSLQHLCRMTVNKCTNKIDELPLPMRLKEYITEYRYHV 202 African clawed frog
AAR97666  167 TSAPSLQHRCRITINKCTNQIWELPLPTRLKEYLKEYRYQV 207 chicken
CAF95062  126 TATPTLQHLCRITINRVARQIQDLPLPSRLKDYLTEYTYHV 166 Tetraodon nigroviridis

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap