Conserved Protein Domain Family
PDI_a_ERdj5_N

?
cd03003: PDI_a_ERdj5_N 
PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains. This subfamily is comprised of the first TRX domain of ERdj5 located after the DnaJ domain at the N-terminal half of the protein. ERdj5 is a ubiquitous protein localized in the endoplasmic reticulum (ER) and is abundant in secretory cells. It's transcription is induced during ER stress. It interacts with BiP through its DnaJ domain in an ATP-dependent manner. BiP, an ER-resident member of the Hsp70 chaperone family, functions in ER-associated degradation and protein translocation.
Statistics
?
PSSM-Id: 239301
View PSSM: cd03003
Aligned: 6 rows
Threshold Bit Score: 189.273
Threshold Setting Gi: 17510057
Created: 15-Apr-2005
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
catalytic
Feature 1:catalytic residues [active site]
Evidence:
  • Comment:CXXC motif
  • Comment:based on known function of the redox active TRX domains of PDI
  • Comment:Studies on PDI show that a conserved arginine affects the pKa value of the active site cysteine and is critical in reoxidation function.
  • Citation:PMID 8639681

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                     #  #                                              
gi 24308127 129 PEIITLERREFDAAVNSG-ELWFVNFYSPGCSHCHDLAPTWRDFAKEVDGLLRIGAVNCGDDRMLCRMKGVNSYPSLFIF 207
gi 50750359 129 PEIITLDRGEFDAAVNSG-ELWFVNFYSPRCSHCHDLAPTWREFAKEMDGVIRIGAVNCGDNRMLCRIKGINSYPSLYVF 207
gi 47122966 130 LEIITLDRGEFDGAVNSG-ELWFINFYSPGCSHCHDLAPTWRQFAKEMDGLLRIGAVNCGDNRMLCRSQGINSYPNLYIF 208
gi 17510057 116 QEIVTLNRADFQRMVSDSnEIWFINFYSTYCSHCHQLAPTWRKFAREIEGTIRVGAVNCAEDPQLCQSQRVNAYPSLVFY 195
gi 68366894 128 PEITTLDRGDFDAAVNSG-EVWFVNFYFPRCSHCHDLAPTWREFAKEMDGVIRIGAVNCGDNGMLCRSKGINSYPSLYVF 206
gi 72006969 129 PEIVTLSKSDFEQSVFGE-DIWIVNFYSPRCHHCHDLAPAWREFAKEVEGVIRVGAVNCWDDRPLCTAQNVKRFPTLFVY 207
                        90       100
                ....*....|....*....|..
Feature 1                   #         
gi 24308127 208 RsgmAPVKYHGDRSKESLVSFA 229
gi 50750359 208 KtgmQPVKYYGDRSKESLKNFA 229
gi 47122966 209 KsgmNPVKYYGERSKERLVNFA 230
gi 17510057 196 P---TGEFYQGHRDVELMVDFA 214
gi 68366894 207 RagmNPEKYFNDRTKSSLTKFA 228
gi 72006969 208 P---KHEEYTGTRSLEPLVKFA 226

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap