Conserved Protein Domain Family
Peptidase_C19Q

?
cd02673: Peptidase_C19Q 
A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Statistics
?
PSSM-Id: 239138
View PSSM: cd02673
Aligned: 5 rows
Threshold Bit Score: 202.759
Threshold Setting Gi: 17510895
Created: 26-Apr-2005
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Active Site
Feature 1:Active Site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1          #    #                                                                       
gi 17510895 283 RLYNTGNSCYFNSTMQALSScpslvsrfemlhrlrhgnylecpsydlrpkfavfes--------clrmmvklsdrmenph 354
gi 24460020 215 QLVNTGNSCYYNSTMQAVSScnplvirceqlyrmvrdnielfddsmnndqadikrkyi----vlqnflkvviclgwhfnk 290
gi 39580778 232 SLHNIKNTCYFNATLQALAScpsmvsrfhqmslimeriklrsfysentdiknkl------------alfvgfqkvfmflt 299
gi 7495349  145 KLVNTGNSCFLNSTMQALSSchsfalrceqlyclvrknidyfdneashsevlcrkyr-------vlidflkimaaltkrs 217
gi 39580777   7 RLENIGNSCYFNSTLQALSScypfssrcvhlkrttsfegklfktketemstkyeffqlfiglisylsltdddddvfsknl 86
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 17510895 355 lkeyrlpsfsetelantrlkIGRVVKEFDNNDQKDAHEYLTELLSCVDdimqvv---------------pdeikhLDPLN 419
gi 24460020 291 rnegksielrrydllqyrqnVGKINEEFNNDDQQDAHEFLLTLIGAVDdamgvmsknv--------ktidnvgitLNPAR 362
gi 39580778 300 kpekstesfnrdelkrilenLNKVISGFIYDKQQDVQEFLDFTFHAIDdimknemprkeaigdessvfyggsiasLNPLL 379
gi 7495349  218 nssktqpeiieanlqtfrelIGMIRNDFANKNQQDAHEFLLMLFEAIDdvaeykadne--------gddvkeakqLNPIE 289
gi 39580777  87 ptrisrklsifqkleefrkmIGKINTILDNSLQQDAHECLGTVLEIMNdlfqsnrtlvg------pppsninvsrLNPAE 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 17510895 420 SIRYKTERSficfncg-------------------heekssdCGWILPLSISnn---dyGIIELLESNFKTTLetnkics 477
gi 24460020 363 AFKIDVETMyvcqgcs-------------------neelkvdSRNDLGVSVMd-----gCSVQKLVSSFVKWSpiekecs 418
gi 39580778 380 PMRYSIESSkscckcd-------------------destviaVDHFLRVSMQpsdgftsVELTDLITNDFKAKkverdcs 440
gi 7495349  290 AFKFNVETCyvckgcs-------------------keevrvdVRNDLAVHMRdn----lSVQELLSSSFSTWTpiekkcs 346
gi 39580777 161 VFKLTIESIsliitlkrynyernavkkkhcsveasfninvssLGVFRDVDHIhle--klDIDESSIFPSKPFSpsek--- 235
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 17510895 478 scscenavsserIANFPef----------------------------------------------------vdLFSVNIL 505
gi 24460020 419 sckhkissscerISTFPe------------------------------------------------------cLIINLKR 444
gi 39580778 441 kckcesaisrdrFVTFPq------------------------------------------------------cLAVHLKR 466
gi 7495349  347 scnhqhailserITRFPe------------------------------------------------------cLVINLER 372
gi 39580777 236 --------vipdDMTTPkelvfdlltewktvkgilkrldidhaeeklrchletlkhesgkqmtrtdlpgktafISADGNC 307
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 17510895 506 Rfywsrhgyrthknsqpcgycscevtivrrpklys--------------------------------------------- 540
gi 24460020 445 Yelegqgppfsmkkkscrvepsfkldvsslgnfppvehpemfenkeysttepvnsedsrlaeittddahfndsrvsgrll 524
gi 39580778 467 Scrdenqtnyknehdikirleldlskyssfcpiaenantsssklsvknfnsnleknhtplkvlggarevsldteevqfdn 546
gi 7495349  373 Yqlegpqfstkkincslepsfeld-------------------------------------------------------- 396
gi 39580777 308 Fyraiswcl----------------------------------------------------------------------- 316
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 17510895 541 ------------------------------------------------------------------enignigkarknsl 554
gi 24460020 525 ggadeemsqcsvivedvkkrkelyfnifsnekdfddildemginngenqkrfhferhitgppskmyqfqlpgatrgitpd 604
gi 39580778 547 eii----------------nhslhfkplrsypnivrmleeldikyddailrthvkklakirpsdmtkndepdqiqeiead 610
gi 7495349  397 ------------------------------------------------------------------------------is 398
gi 39580777     --------------------------------------------------------------------------------
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 17510895 555 llknknrhlpigclilnpmrYERTSISDYRKDNRQITVPLTLdltrfgafasleqdenrnsvsfgscgkdsikyrngpsi 634
gi 24460020 605 gncfyraiswwitgvqshhmIFREAVGKHLKKNELMFKKYCHneiyekyvenamrdgvwattceifamanmlnveiityl 684
gi 39580778 611 gncffraiswcltgseahhkKLRRATADYLKDNKPALKKYQSnfeahakkmkqnaewatncevaaiskmlsvniytylss 690
gi 7495349  399 slqkfpeiekngleqsekqqDSQYGQLLDRMKSCEIIKCCETknii---------------------------------- 444
gi 39580777 317 ------------tgsqryhrKLRIATSEYLKKNEESMRKFCGgeldykkyvenvrkdgewatssgwrshvphdggsskec 384
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 17510895 635 gprllslnggslddeeidiemmkevvknplhfkwltdldeieqmlkltnityrrddvkihvekleneksvvmkkfdrpgr 714
gi 24460020 685 gdsgwvphspqnnypp---------------------------------------------------------------- 700
gi 39580778 691 gwtcqspsnnevtvvgsiylnnvsehyepvlsl----------------------------------------------- 723
gi 7495349      --------------------------------------------------------------------------------
gi 39580777 385 iflsnt-------------------------------------------------------------------------- 390
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 17510895 715 vkgiesdgncfyraiswcltgsqkyhkalriatanylrndiaivdkychktdhktyvqqvegdgwwatnveicvmanlln 794
gi 24460020     --------------------------------------------------------------------------------
gi 39580778     --------------------------------------------------------------------------------
gi 7495349      --------------------------------------------------------------------------------
gi 39580777     --------------------------------------------------------------------------------
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 17510895 795 vniytflsdgwictspqnsstsrsgsfylenkdchyepvlslkkddslrsrkrrntdteytddnegggfkkrkpdddasr 874
gi 24460020 701 -----------------------------------------------------------rkgaiylkntnmhyepttslr 721
gi 39580778 724 -------------------------------------------rkgqsearsiraqkrsapdsddeksmddndesfkpar 760
gi 7495349      --------------------------------------------------------------------------------
gi 39580777 391 ---------------------------------------------------------------------schfepttslk 401
                       810       820       830       840       850       860       870       880
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                             #                  #      
gi 17510895 875 kprnlseserrrqpprdaedngnhykkmnantdQIAKYRLFAAICHIGEfpdRGHYLALTRdlynpskWLDCSDAVVRDI 954
gi 24460020 722 knsperspmkkentngssmhdeldendylksdiHPGTYSLVAVVCHLGDspnKGHYVAYTKelyknssWLRCSDDNIYAV 801
gi 39580778 761 pkmngdsktsrkeassskgfvndkktntttkdnELASYNLVAVICHYGPsvlAGHYITFSKsiy-cdeWLKCDDETITPV 839
gi 7495349  445 ------------------------------meeKHDKYSLVAAICHLGEtptNGHYIAYTRedt-ensWLYCSDDLIRPA 493
gi 39580777 402 pfiaekekdekseiyqssrsdsqcnqkrcrgerTDPNYSLMAVVCHFGEspyDGHYVAYTKnssngeqWVYCSDTEVHEV 481
                       890
                ....*....|....*....
Feature 1                          
gi 17510895 955 SSgdvikdassSGYLLFYD 973
gi 24460020 802 SKndvseairsSGYLMFYE 820
gi 39580778 840 SKntvlteatsAGYLIFYD 858
gi 7495349  494 TRseislsirtSGYILFYE 512
gi 39580777 482 NKdava-nairSSGYIFFY 499

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap