Conserved Protein Domain Family
Peptidase_C19I

?
cd02665: Peptidase_C19I 
A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Statistics
?
PSSM-Id: 239130
View PSSM: cd02665
Aligned: 7 rows
Threshold Bit Score: 201.633
Threshold Setting Gi: 39587259
Created: 22-Apr-2005
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Active Site
Feature 1:Active Site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1           #    #                                                                       
gi 50760129  133 GMKNIGNTCWFSAVIQSLFQlpqfrrlvlsysfppnvlescrtrtgkrniafmqe-------lqclfalmlgtrrkfvdp 205
gi 1351352   200 GLYNSGNTCWLNCLSQVLYSipkfrsilyhcaplswheqpitnvkienqqhaellmlfrglfaelqfsemkyievgplin 279
gi 50417500  169 GLKNVGNTCWFSAVIQSLFNllefrrlvlnynppssaqdvprnqkehrnlpfmre-------lrylfslmvsskrkyvdp 241
gi 49533613  169 GLKNVGNTCWFSAVIQSLFNllefqrlvlhyspparmqdlprnqkehrnlpfmqe-------lrhlfsllvgskrkyvdp 241
gi 39587259  144 GLFNQGNTCWFNSLTQMLFSipkfrsvlynctpltwheqpiknvqvqfelhadllirfrrlfvelyfseeshvvageilt 223
gi 20140700  163 GLKNVGNTCWFSAVIQSLFQlpefrrlvlsyslpqnvlencrshtekrnimfmqe-------lqylfalmmgsnrkfvdp 235
gi 55637191  247 GLKNVGNTCWFSAVIQQDVSefthkll----------------------------------------------------- 273
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 50760129  206 saalellrdafksteeQQQDVSEFTHKLLDWLEdafqlavnv-------------------------------------- 247
gi 1351352   280 mvdklsksskgpstigTQQDATEMLTLIFDWLQrafdaalhaqlnpefsnvsdeenlvisdsttt--------------- 344
gi 50417500  242 sraveilkdafksndsQQQDVSEFTHKLLDWLEdafqikaee-------------------------------------- 283
gi 49533613  242 sgaveilkdafkssesQQQDVSEFTHKLLDWLEdafqikaee-------------------------------------- 283
gi 39587259  224 ivdrlytakggpstigSQQDASEMLTLIMQWLGysinaaiyahlhsnftrvideennmvishsseqapnsdvagtlppvy 303
gi 20140700  236 saaldllkgafrsseeQQQDVSEFTHKLLDWLEdafqlavnv-------------------------------------- 277
gi 55637191  274 ----------dwledaFQLAVNVNTYLNPNNPElspfpkss--------------------------------------- 304
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 50760129      --------------------------------------------------------------------------------
gi 1351352   345 -------------------------------------------------------------------apnsdiigappgy 357
gi 50417500      --------------------------------------------------------------------------------
gi 49533613      --------------------------------------------------------------------------------
gi 39587259  304 qenvqdlasstsvkreaesranspvknvpardsfggpaaksprtspsdlpqieeamdtsegpdtqarpkaesvenprape 383
gi 20140700      --------------------------------------------------------------------------------
gi 55637191      --------------------------------------------------------------------------------
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 50760129  248 -----------rspgdkseNPMVQLFYGTFLTEGVHEGntf--------------------------------------- 277
gi 1351352   358 naanlslpssshvdpkstlNPMYVNEKEPSSTPTSLFGtrsktievnesmdteaatssnlpgnsvenhpnpaapevddnk 437
gi 50417500  284 -----------erdgekpkNPMVELFYGRFLAVGVHEGkkf--------------------------------------- 313
gi 49533613  284 -----------dregekpkNPMVELFYGRFLAVGVLEGkkf--------------------------------------- 313
gi 39587259  384 ameekavdartielvekikHDYAQIFQATSHMEKFSDSgelvgd------------------------------------ 427
gi 20140700  278 -----------nsprnkseNPMVQLFYGTFLTEGVREGkpf--------------------------------------- 307
gi 55637191  305 ------------sprnkseNPMVQLFYGTFLTEGVREGkpf--------------------------------------- 333
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 50760129  278 ------------------------------------skIETFGQYPLQvngyrNLNECLEGAMVEGEmdeetatq----- 316
gi 1351352   438 kafcdklkesfnnifssvcytesvaedgtvsvksnvrnCPQFFQLQVTy---gNLHDALEAATFDHGlgnta-------- 506
gi 50417500  314 ------------------------------------enTEMFGQYPLQvngfkDLHECLEAAMIEGEieslhsen----- 352
gi 49533613  314 ------------------------------------enTEMFGQYPLQvngfkDLHECLEAAMIEGEieslhsaen---- 353
gi 39587259  428 --------------------------------vntnmhCPVCFNLPVSy---gNLHDALEASTFEVRadgdkt------- 465
gi 20140700  308 ------------------------------------cnNETFGQYPLQvngyrNLDECLEGAMVEGDvellpsdh----- 346
gi 55637191  334 ------------------------------------cnNETFGQYPLQvngyrNLDECLEGAMVEGDvellpsdhsvkyg 377
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 50760129      --------------------------------------------------------------------------------
gi 1351352       --------------------------------------------------------------------------------
gi 50417500      --------------------------------------------------------------------------------
gi 49533613      --------------------------------------------------------------------------------
gi 39587259      --------------------------------------------------------------------------------
gi 20140700      --------------------------------------------------------------------------------
gi 55637191  378 qerwftklppvltfelsrfefnqslgqpekihnklefpqiiymdrymyrskelirnkrecirklkeeikilqqklestvs 457
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 50760129      --------------------------------------------------------------------------------
gi 1351352       --------------------------------------------------------------------------------
gi 50417500      --------------------------------------------------------------------------------
gi 49533613      --------------------------------------------------------------------------------
gi 39587259      --------------------------------------------------------------------------------
gi 20140700      --------------------------------------------------------------------------------
gi 55637191  458 ysgdvlhneyilppghnvdcqtryvkygsgparfplpdmlkyviefastkpasescppesdthmtlplssvhcsvsdqts 537
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 50760129  317 --------------------------svkyvqerWFTKLPp-----vLTFELSRFefnqslgqpeKIHTKLEFPQTIymd 365
gi 1351352   507 -----------------------------shvrnLYDPLPa-----vIFFGLSRFsfns--niesKLHDKFTFPKIIfmd 550
gi 50417500  353 --------------------------sgksgqehWFTELPp-----vLTFELSRFefnqalgrpeKIHNKLEFPPCLymd 401
gi 49533613  354 --------------------------saksgqehWFTELPp-----vLTFELSRFefnqalgrpeKIHNKLEFPSMLymd 402
gi 39587259  466 -----------------------------vntrsMYEALPa-----vFFVSLNRFhfgk---sgaKLHDKFTFPREIfmd 508
gi 20140700  347 --------------------------svkygqerWFTKLPp-----vLTFELSRFefnqslgqpeKIHNKLEFPQIIymd 395
gi 55637191  538 keststesssqdvqstfsspedslpkskpltssrSSMEMPsqpaprtVTDEEINFvk------tcLQRWRSEIEQDIqdl 611
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 50760129  366 rylycskeliqtkreemkklkekmlvlqqklerymkygsgparfplpdmlqyvlefittkpagavssacvsstedsqmmd 445
gi 1351352   551 rylkcnkeqlvqlrshrelcrdslsevraklsglrrypqgngevrledsfqtvwqavsnfrefvtfylkvsqktffsred 630
gi 50417500  402 rymhknreitrlkrdeikrlkdhltvlqqrlerylsygsgpkrfpladvlqyalefasskpvctspvedidvsappsgcv 481
gi 49533613  403 symdrnreitrikreeirrlkehltvlqqrlerylsygsgpkrfpladvlqyamefasskpvctspvedidttappggti 482
gi 39587259  509 ryirknadlitplrakladlrnklseararlnglhhyphgtmnlnvinlidafqsvlnattnsrtsedps---------- 578
gi 20140700  396 rymyrskelirnkrecirklkeeikilqqkleryvkygsgparfplpdmlkyviefastkpasescppesdthmtlplss 475
gi 55637191  612 knciasttq----------------------------------------------------------------------- 620
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 50760129  446 rqsqgeslilgtpsqpdsmldgkdgkpedeavllansspqqqlnaplqpseppaemsdcpaphvvseeemnlvttclqrw 525
gi 1351352   631 ah------------------------entafvgpltpstyqsssdncsskfvkdggklfptftegffpgkaafietlqnm 686
gi 50417500  482 atqtvqs--------------ttehqgsssasetqlptqrsvihkpftqsrippdlpmhpaprnitdeelsvlegclhrw 547
gi 49533613  483 aqlpppasageq-----pdacvsaegsgsglqasqqqqqrvsihkpftqsrvppdlpmhpaprhiteeelrvlesclhrw 557
gi 39587259  579 --------------------------------------pfrppnnygnslnfikdqgkifpvfeesfpdlhamnrglkda 620
gi 20140700  476 vhcsvsdqtsk-------eststesssqdvestfsspedslpkskpltssrssmempsqpaprtvtdeeinfvktclqrw 548
gi 55637191      --------------------------------------------------------------------------------
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                           #                    #       
gi 50760129  526 rneieqdvrdlkesiarislsidemysdphlQQVPYHLHAVLVHEGQanAGHYWAFIYdqp---rksWLKYNDISVTESS 602
gi 1351352   687 lealkteerdclaeearlqevidqtyevpelQQHKYELHAIIVHSGEanRGHYWTYKLkksidgleeWEKLNDQNADRVD 766
gi 50417500  548 rtevetdtrdlqdsigrihrtielmysdkqmNQVPYKLHAVLVHEGQanAGHYWAYIFdhh---eqrWMKYNDISVTKSS 624
gi 49533613  558 rsevendtrdlqasisrihrtielmysdksmMQVPYRLHAVLVHEGQanAGHYWAYIYdrh---hqrWMKYNDIAVTKSS 634
gi 39587259  621 lselksteaallefmarleqeiqgiyeveelKKENYELKAMILHVGEinRGHYWMYKLkrsidgfeeWEKLNDQSATPVD 700
gi 20140700  549 rseieqdiqdlktciasttqtieqmycdpllRQVPYRLHAVLVHEGQanAGHYWAYIYnqp---rqsWLKYNDISVTESS 625
gi 55637191  621 --------------------tieqmycdpllRQVPYRLHAVLVHEGQanAGHYWAYIYnqp---rqsWLKYNDISVTESS 677
                        890       900
                 ....*....|....*....|....*
Feature 1                                 
gi 50760129  603 WEELERDSFGGlr--naSAYCLMYI 625
gi 1351352   767 WPKVESDSFGTgsrdapSAYMLMYV 791
gi 50417500  625 WEELERDSFGGyr--naSAYCLMYI 647
gi 49533613  635 WEELVRDSFGGyr--naSAYCLMYI 657
gi 39587259  701 YSQIEKEAFGTgistdpSAYLLLYV 725
gi 20140700  626 WEEVERDSYGGlr--nvSAYCLMYI 648
gi 55637191  678 WEEVERDSYGGlr--nvSAYCLMYI 700

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap