Conserved Protein Domain Family
Peptidase_C19F

?
cd02662: Peptidase_C19F 
A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Statistics
?
PSSM-Id: 239127
View PSSM: cd02662
Aligned: 19 rows
Threshold Bit Score: 138.653
Threshold Setting Gi: 49654381
Created: 22-Apr-2005
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
 
Active Site
Feature 1:Active Site [active site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1          #    #                                                                       
gi 136683   102 GLVNDGNTCFMNSVLQSLASSRELMEFLDNNVirtyeeieqnehneegngqesaqdeathkkntrkggkvygkhkkklnr 181
gi 7270921   75 GLQNLGNNCFLNVILQALASCKDFRSFLQWVLedargslageqeeqlpltfalsallqelg------------------- 135
gi 18858101  40 GLHNFGLTCFLNTLLQAMAACPQFIAWLQLYNnaspdrkslitsmlntlevvngtha----------------------- 96
gi 28950326 161 GLGNNDNSCYQNSILQGLASLQGLPEYLARVSqlgsnakstmpttqamagliatl------------------------- 215
gi 32564647  46 GLANQGNTCYMNALLQGLASCPSFVGWLKSLKpqdigiqggfvdhlsnllhllnep------------------------ 101
gi 38345453  65 GLKNLGNNCFLNVILQALASCDGFVSSLDNLLgsedvlpeeksekmplifalsslikven-------------------- 124
gi 40738406 142 GLGNWDNSCYQNSIIQGLASLPSLAEFLERNIsslggkislsthealkeiidrl-------------------------- 195
gi 49647237  13 GLENDSAFCFMNSVLQSMASLDRLDEFLGGTQyegveldtttrkryeeseneddsdegaengpegpvseaeteidqvpdr 92
gi 49652431 133 GISNDGNTCFMNSVLQSLASSKHLLKFIDSYLyseieisgeptpttvksntpkpdlvftaalrrfle------------- 199
gi 50756498 131 GLLNLGNTCFMNSLLQGLSSCPSFIRWLEEFTaqy--------------------------------------------- 165
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 136683   182 ksssked------------------------------------------------------------------------e 189
gi 7270921      --------------------------------------------------------------------------------
gi 18858101     --------------------------------------------------------------------------------
gi 28950326     --------------------------------------------------------------------------------
gi 32564647     --------------------------------------------------------------------------------
gi 38345453     --------------------------------------------------------------------------------
gi 40738406     --------------------------------------------------------------------------------
gi 49647237  93 tqptvpegasavpeaeddlvevnavaeeeeqeeelkqpsalelsslipgfpaqpekadpeevtevtetsttvqnpicpss 172
gi 49652431     --------------------------------------------------------------------------------
gi 50756498     --------------------------------------------------------------------------------
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 136683   190 eksqepditfsvalrdllsalnakyyrdkpyfktnsllkamsksprknillgyDQEDAQEFFQNILAELEsnvkslntek 269
gi 7270921  136 -------------------------tvgsrrsvsnprkvmvtltdyaknfnltSQQDAAEALLHLISSLQeeivv----- 185
gi 18858101  97 ----------------------------tlrgdpyspgavlralnalgwvipqEEHDAHELFHVLLTCLEeeairpqplg 148
gi 28950326 216 -------------------------------ndkanygrsvwppnvlknmstwQQQDAQEYFSKLLDQIDrevakataty 264
gi 32564647 102 -----------------------------tgstltaqsiveslkahgwsitvgVEHDLYELFNVFVTTWE---------- 142
gi 38345453 125 -------------------------kvlvpvtlvvsgiteqwwsggivtycntVNTDASEAFHHLLTSLRdefsrcyvpn 179
gi 40738406 196 -------------------------------nsadnhgqrlwappdlksmsswQQQDAQEYFSKVVDQLDhevqqatrrr 244
gi 49647237 173 lesfhsstglgafsyelkrmfaqlntlsnrshtysglpitramgksgqrwdgyEQEDAGEFFQQLIDRLEnevkakagga 252
gi 49652431 200 -------------------gingsygsrgkefsakpllnkmpngpkqnfftgyNQEDAQEFYQLVMNLVEteykkdsksr 260
gi 50756498 166 ---------------------------------------------------kaEQNQPSEQQCLSLTLLHllrde----- 189
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 136683   270 ldttpvakselpddalvgqln----------------------------------------------------------- 290
gi 7270921      --------------------------------------------------------------------------------
gi 18858101 149 clsdalptdnddnsslagtatpvggfrsfssmaaglgasqrigdqpnrpssamltdflnmeydestslqrlvrseahtpd 228
gi 28950326 265 kkslaydgdpppdd------------------------------------------------------------------ 278
gi 32564647     --------------------------------------------------------------------------------
gi 38345453 180 rssladitmf---------------------------------------------------------------------- 189
gi 40738406 245 trnlglkmagpq-------------------------------------------------------------------- 256
gi 49647237 253 dkvee--------------------------------------------------------------------------- 257
gi 49652431 261 qlspepdssekspsdkfvdsalvpn------------------------------------------------------- 285
gi 50756498     --------------------------------------------------------------------------------
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 136683   291 ----------------------------------------------------------------lgevgtvyipteqidp 306
gi 7270921      --------------------------------------------------------------------------------
gi 18858101 229 spasvcerdgndrlgsvlldavspgtpfgfplvsnpdslatpmlggerssrprlpqsqqqqdeglnrrvssscrslerlh 308
gi 28950326 279 ----------------------------------------------------------------------gvsshhsdds 288
gi 32564647     --------------------------------------------------------------------------------
gi 38345453 190 ---------------------------------------------------------------------------pskvy 194
gi 40738406 257 ------------------------------------------------------------------------ehvigtta 264
gi 49647237     --------------------------------------------------------------------------------
gi 49652431 286 ------------------------------------------------------------lisgceelgrlgkvyvpasq 305
gi 50756498     --------------------------------------------------------------------------------
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 136683   307 nsilhdksiqnftpFKLMTPLDGITAERIGCLQCGENggi-----------------rysVFSGLSLNLPneni------ 363
gi 7270921  186 ----------cyrpSQSSNLSDILFSRNLRMLAPSEGlhgl----------------melKRWHKHLRGPfdgilgstlm 239
gi 18858101 309 rgpgrvsiwsnmmpSQVAHPFQGAMGAQIVCNGCGSKsav-----------------rydKFDSITLNLPpqrr------ 365
gi 28950326 289 gyhsssqsssvpdiQLSRNPLEGLIAQRVVCVKCNHFeglt----------------mipFNCLTLNLGSgqlgydlyer 352
gi 32564647 143 --------------DELKSSRRILMNQSIENCHSSSSeddedvvrfgrgklaknrtvkyeSFTVLTLAIPnsqm------ 202
gi 38345453 195 sqregnqpeckrwkQNLFGPFDGTIGSILSCRNCSSVlsl-----------------dfeNFYCLPLSPVatingd---- 253
gi 40738406 265 aqsdgpmhpgrlenQSFRNPLEGLLAQRVGCAGYEYDvrdcldhym-----nleqiegveCAKCTLLRARdqlrnlmqqi 339
gi 49647237 258 ktisedtsaldkwkKKMLIPFDGVQATTIKCLTCGDLgdgi----------------rynIMGALGLSLPnqtsrf---- 317
gi 49652431 306 vdpnlleidhkvypLDLVTPVDGISVERIGCLACGEVggi-----------------rysVNSGLSLNLPnkss------ 362
gi 50756498 190 ----------rdrqPRVTHLFDVHSLEQPEITQKQIS-----------------------CRTRGSLPPMsnhwksqhpf 236
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 136683   364 --------------------------------------------------gstlKLSQLLSDWSKPEIIEGVECNRCalt 393
gi 7270921  240 c-------------------------------------------rtcssqmsgcTLEHCLKKFLNTEKVENYFCYRCwhg 276
gi 18858101 366 ---------------------------------------------------tglSLGHLLSEYITSEDLSDVKCDSCnet 394
gi 28950326 353 ldynarvefiegvhcprcsllkmqqkikgligmvatdearvsefrerlaaveeaLEEDMLDDKTLAEKCKVPAKQRVest 432
gi 32564647 203 --------------------------------------------------gtstNTESLLRRFFCSEIIRDAICDKCras 232
gi 38345453 254 -------------------------------------------------iingcSLVDCLEHFTALEHLDNYRCDHCwhn 284
gi 40738406 340 eddeklvea--------------------------kertkvsdalkssaeqrlqAVEEALEEADFTEKTLSKKCHIPskn 393
gi 49647237 318 -------------------------------------------------srsthTLKECIDMFAEREIIDGVSCERCslq 348
gi 49652431 363 --------------------------------------------------ysgyDLDSLMNDWIAPEIIEDVNCNRCglv 392
gi 50756498 237 hgrlt----------------------------------snmvckhcehqghpmTLDHCLHHFISSESVKDVVCDNCtki 282
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 136683   394 aahshlfgqlkefekkpegsipekpinavkdrvhqieevlakpviddedykklhtanmvrkcskskQILISRPPp--lLS 471
gi 7270921  277 aalk-------------------------------------------------------ylsvigaAEGHIAFP----LV 297
gi 18858101 395 t-------------------------------------------------------------thtkSVTFAKLPa--cLC 411
gi 28950326 433 ---------------------------------------------------------------ktkQTAISRPPk--sLV 447
gi 32564647 233 drk---------------------------------------------------------qqgflkKHGIVKLPq--tLM 253
gi 38345453 285 vaakylslksevdeekinklhtcv----------------dygtcscrhiftpeemtcsissqatkQLAITHFPk--iLC 346
gi 40738406 394 rvt----------------------------------------------------------ttksrQAVIARPPg--cLA 413
gi 49647237 349 eykrqvedqiskvadtasplvqlfqtrldkv-dtalsrdtineeeyndifkkntggfakvfvqkskQTLIGVAPq--iLC 425
gi 49652431 393 qtkafllskiseannekiigqfqnrade-------iekellqphitdevfeklsikqmirktkkskQISLSRPPp--lLT 463
gi 50756498 283 qaegtl---------------------------------------------------ngqsvenqkTTFVKQLKlgkcLC 311
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 136683   472 IHINRSvfdprtymirKNNSKVLFKSRLnlapwccdineinldarlpmskkekaaqqdssedeniggeyytklherfeqe 551
gi 7270921  298 LNLSLFt---------PSSIGVNIEERIemsseyq--------------------------------------------- 323
gi 18858101 412 IHVARTvwlpt-gqvcKRKDYVHFPESLsmapysfvqphlnsqagtpwgstm---------------------------- 462
gi 28950326 448 IHINRSvfdertgymyKDSSAVRFPSILdlgpwclgsakkradlegsngvlpsstsn----------------------- 504
gi 32564647 254 IRIERVgmlp--ngsmKLSEHVHFGECLslqdvcfrknpkinqksyeesslhwqlpdgtsrvvggae------------- 318
gi 38345453 347 IHLLRAsvgld-gefvKRGGHISFPLLLdlspfaggalipgqgpkpsamnkqrhgqqtlhlwrqlnaempvn-------- 417
gi 40738406 414 IHINRSvfdehtgllrKNYAAVKFPRVLdlgewclggsydeaikqkve-------------------------------- 461
gi 49647237 426 VTINRSqfdmntgmsfKNSANVRFPSLLcldewm---------------------------------------------- 459
gi 49652431 464 IHINRSvfdpktymivKNPSNVSFPSRLdltsyvtepkdinmdarlpfrkqdertinipladinkpsnsses-------- 535
gi 50756498 312 IHLQRLswsnq-gtplKRHEHVQFNEFLimdiykyhipvhkstqsdlnqksseetkpgtkdglavkp------------- 377
                       730       740       750       760       770       780       790       800
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                       
gi 136683   552 fedseeekeyddaegnyashynhtkdisnydplngevdgvtsddedeyieetdalgntikkriiehsdvenenvkdneel 631
gi 7270921      --------------------------------------------------------------------------------
gi 18858101     --------------------------------------------------------------------------------
gi 28950326     --------------------------------------------------------------------------------
gi 32564647     --------------------------------------------------------------------------------
gi 38345453     --------------------------------------------------------------------------------
gi 40738406     --------------------------------------------------------------------------------
gi 49647237     --------------------------------------------------------------------------------
gi 49652431     --------------------------------------------------------------------------------
gi 50756498     --------------------------------------------------------------------------------
                       810       820       830       840       850       860       870       880
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                        #              
gi 136683   632 qeidnvsldepkinvedqletssdeedvipappinyarsfstvpaTPLTYSLRSVIVHYGThnYGHYIAFRKyr------ 705
gi 7270921  324 ---------------------------------------kpeaskNHGMYRLVTVVEHFGRtgSGHYTVYRSvrvfsqee 364
gi 18858101 463 ----------------------slyssslpmnngvgggegfgtmfPKNLYRLLAVVVHSGEanSGHFVTYRRgslr---- 516
gi 28950326 505 ----------------geqtaedeekwnveptasmvagsqrpsalSGPLYELRAVVTHQGRhdSGHYVCYRKhyisppek 568
gi 32564647 319 ------etrsrrspihpsqaaifgdlasnyalidggsfvaerreaQKYAYQLRAVSEHRGGpySGHFVTYRRasap---- 388
gi 38345453 418 -mfpaatdgdssshhcgdesintlgrsfyvgnrdadsrflsssslTDKLYGLSSVVEHYGVcgGGHYAAYRRvtpnsdsn 496
gi 40738406 462 --------------------------nwgtdprvsmlhppgaardGDRRYELRAVVTHYGRheNGHYICYRKhpvevfpa 515
gi 49647237 460 ----------------------------------------ddksqTKKMYRLKSVVSHYGShdYGHYIAYRLsr------ 493
gi 49652431 536 --essntvsmsdqdnfedkelsqsdrysnstsdssenqdncialnPKLLYNLKAVISHFGThnYGHYICYRRlr------ 607
gi 50756498 378 ------sdaeqtcgtksllmngacsssflmssgtfpltafpecssPVYLYRLMAVVVHHGDmhSGHFVTYRRsppsskn- 450
                       890       900       910       920       930       940       950       960
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                            #          
gi 136683   706 --------------------------------------------------------------gcWWRISDETVYVVDEae 723
gi 7270921  365 e------------------------------------------------------eedcdedlsWFSISDSEVCRVSEsd 390
gi 18858101 517 ------------------------------------------------------------nahrWYYTSDTIVREVSIde 536
gi 28950326 569 enqpeapppqlvaddevaapkiqaldqksiseqdttdeedaptptseddektlmredeeeatsqWWRLSDTDVFKVDEen 648
gi 32564647 389 ------------------------------------------------------------nhhtWYYTSDAQVTRVPYsh 408
gi 38345453 497 ep----------------------------------------------------vqslasfrkeWLYVSDDHVSHVSEce 524
gi 40738406 516 qvpea----------------------------------------------vleadgekerserWYRLSDEDVQMVSEen 549
gi 49647237 494 --------------------------------------------------------------dkWWRISDETVYQTELsy 511
gi 49652431 608 --------------------------------------------------------------gsWWRISDESVYVVTEne 625
gi 50756498 451 ---------------------------------------------------------plsvsnqWLWISDDTVRKASLqe 473
                       970
                ....*....|...
Feature 1                    
gi 136683   724 vlstpGVFMLFYE 736
gi 7270921  391 v-lgaEASLLFYE 402
gi 18858101 537 v-lsvPAYLLFYD 548
gi 28950326 649 vlergDVFMLFYE 661
gi 32564647 409 v-aacQSYMLFYE 420
gi 38345453 525 v-laaEATLLFYE 536
gi 40738406 550 vmtqgGAFMLFYE 562
gi 49647237 512 vlsdgSIFMLFYE 524
gi 49652431 626 vlnsqGTFMLFYE 638
gi 50756498 474 v-lssSAYLLFYE 485

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap