1M2O,1M2V


Conserved Protein Domain Family
trunk_domain

?
cd01468: trunk_domain 
Click on image for an interactive view with Cn3D
trunk domain. COPII-coated vesicles carry proteins from the endoplasmic reticulum to the Golgi complex. This vesicular transport can be reconstituted by using three cytosolic components containing five proteins: the small GTPase Sar1p, the Sec23p/24p complex, and the Sec13p/Sec31p complex. This domain is known as the trunk domain and has an alpha/beta vWA fold and forms the dimer interface. Some members of this family possess a partial MIDAS motif that is a characteristic feature of most vWA domain proteins.
Statistics
?
PSSM-Id: 238745
View PSSM: cd01468
Aligned: 27 rows
Threshold Bit Score: 193.231
Threshold Setting Gi: 4314388
Created: 12-Dec-2003
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1M2O_A      119 TVPPIFFFVVDLTSE---TENLDSLKESIITSLSLLPPNALIGLITYGNVVQLHDLSSeti--------drCNVFRGdre 187
gi 4558550  274 SDSRTSAPVVLVIDEcldEPHLQHLQSSLHAFVDSLPQTTRLGIILYGRTVSIYDFSEdsvasadvisgakSPSAESmka 353
gi 12328571 259 PDTRVSGPIFILIDEcldEAHLQHLQGSLHAFVDTLPPTARIGIISYGRTVSVYDFSEgaavsadvlpgnkSPTHESlka 338
gi 3702631  120 QLTPVFLFVVDVCQD---EENLQALKDSLIISLSLLPPECLVGLVTFGTMVDVYELGYtec--------skSYVFRGskd 188
gi 20141794 126 QSPLIFLYVVDTCLE---EDDLQALKESLQMSLSLLPPDALVGLITFGRMVQVHELSCegi--------skSYVFRGtkd 194
gi 4567227  124 PSPPVFLFVVDTCLI---SEELDFLKSSLFQALDLLPDTSILGLITFDSLVRVYELGFphc--------tkSYFFHGnkd 192
gi 14530602 130 TMPPIFVFVVDTCMT---AEELKSLKECLQTALSLLPADALVGLITYGRMVQLHELNTqgi--------srSYVFKGtke 198
gi 4176521  120 KSPPVFLFVMDTAVD---ESELTALKDAVIVSLSLLPPDAIVGLITYGSLIQVHEIGFeam--------pkSYVFQPaad 188
gi 7271162  126 TMPPVFIFLVDTCMD---EEELDALKDSLQMSLSLLPTNALVGLITFGKMIQVHELGAegc--------skSYVFRGtkd 194
gi 2244772  128 PPPPVFVFVLDTCMI---EEELGYAKSALKQAIGLLPENALVGFVSFGTQAHVHELGFsem--------skVFVFKGnke 196
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1M2O_A      188 yqlealtemltgqkptg------------------------------------------------pggaashlpnamnkv 219
gi 4558550  354 l------------------------------------------------------------------------------- 354
gi 12328571 339 i------------------------------------------------------------------------------- 339
gi 3702631  189 ytskqiqemlglptsn---------------------------------------------------vspvalqqarsfq 217
gi 20141794 195 ltakqiqdmlgltkpa---------------------------------------------------mpmqqarpaqpqe 223
gi 4567227  193 ctkdqlldqlsffvknp-------------------------------------------------kpssgviagardgl 223
gi 14530602 199 vtakqikdvmaggglsqrpaagapgapagapgapmamgsgaaplgqlpgsglpgglprgggpplpgaaqgivapgggapv 278
gi 4176521  189 ystmklqqllalsgnqir-----------------------------------------------sssskakisgtgitl 221
gi 7271162  195 ltakqvqdmlgigrraa-------------------------------------------------pgpqqqqhlpgqpa 225
gi 2244772  197 vtkdqildqlglgsssr------------------------------------------------raptsgfskgaqngf 228
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1M2O_A      220 tpfslNRFFLPLEQVEFKLNQLLENLspdqwsvpaghrplRATGSALNIASLLLQgcyk----------nipARIILFAS 289
gi 4558550  355 -iygtGVYLSPMHASLKVAHEIFSSLrpytlnv-peasrdRCLGTAVEAALAIIQgpsaemsrgvvrraggnSRIIVCAG 432
gi 12328571 340 -iygtGIYLSPVHASLPVAHTIFSSLrpyqlsl-pevsrdRCIGAAVEVALGIIQgpaaevsrgiikrsggnYRILVCAG 417
gi 3702631  218 gsaapSRFLLPIQQCEFQLTNILEQLqpdswpvandrrpqRCTGTALNISVSMMEsvcp----------nsgGHIMLFAG 287
gi 20141794 224 hpfasSRFLQPVHKIDMNLTDLLGELqrdpwpvtqgkrplRSTGVALSIAVGLLEgtfp----------ntgARIMLFTG 293
gi 4567227  224 ssddiARFLLPASDCHFTLHSVLEELgnspwpvaadhrpaRCTGVALRIAASLLGacfp----------gsaARIMAFIG 293
gi 14530602 279 phapaNKFLQPISECDESINDLIDQIsidrwpvpqghrplRATGAALAVAVTLLEscfp----------stgARIMSFIG 348
gi 4176521  222 nlgaaSRFLMPVQKCEMHLLNILEQLqpdclevpagqrqlRCTGAAVKIASDLLGiafp----------kcgSRIELFCG 291
gi 7271162  226 gaaapVRFLQPIGQCDAALGDLLSELqrdpwpvpqgkrylRSTGAALSIAVGLLEctyp----------ntgGRIMTFVG 295
gi 2244772  229 qssgvDRFLLPASECEYTLDLLLDELqsdqwpvqpghrpqRCTGVALSVAAGLLGaclp----------gtgARIVALVG 298
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1M2O_A      290 GPGTVAPGLIVnselkdplrshhdidsdhaqhykkackFYNQIAQRVAANGHTVDIFAGCYDQIGMSEMKQLTDSTGGVL 369
gi 4558550  433 GPITYGPGSVPhsmshpnyp----------ymektaikWMENLGREAHRHNTVVDILCAGTCPLRVPILQPLAKASGGVL 502
gi 12328571 418 GPSTFGPGSVPhsvqhpnya----------ylektamkWMERLGHEAQRHSTVVDILCAGTCPVRVPVLQPLAKCSGGVL 487
gi 3702631  288 GPSTVGPGTVVstelrepirshhdierdqakhvkkalrFYEGLTKRVSANGHAVDILAGCLDQIGIMEMKSLASSTGGYL 367
gi 20141794 294 GPPTQGPGMVVgdelkipirswhdiekdnarfmkkatkHYEMLANRTAANGHCIDIYACALDQTGLLEMKCCANLTGGYM 373
gi 4567227  294 GPSTQGPGAIVsrelsdpirshkdidkdsamyyhkaveFYEMLAKQLVHQGHVLDVFASSVDQVGIAELKVAVEQTGGFV 373
gi 14530602 349 GACTHGPGAVVgeelknpirswnsikedaapymkkaikFYDGLAARIVKNGHAVDVYSCALDQTGLLEMKNMFNSSGGHV 428
gi 4176521  292 GPCTVGLGQVVstelkepmrshseiandkakhfkkskkFYSSLAERLSNQGHALDLFAGCLDQVGIMEMENLVNNTGGAI 371
gi 7271162  296 GPCSQGPGQVVddelkhpirshhdihkdnvrfmkkaikHYDALALRAATNGHSVDIYSCALDQTGLLEMKQLCNSTGGHM 375
gi 2244772  299 GPCTEGPGTIIskdlsdpvrshkdldkdaapyykkavkFYDSIAKQLVAQGHVLDLFASALDQVGVAEMKVAVESTGGLV 378
                       330
                ....*....|....*..
1M2O_A      370 LLTdafstAIFKQSYLR 386
gi 4558550  503 VLHdd-fgEAFGVDLQR 518
gi 12328571 488 LLHdd-fgEAFGVNLQR 503
gi 3702631  368 VLSdsfttSIFKQSFQR 384
gi 20141794 374 VMGdsfntSLFKQTFQR 390
gi 4567227  374 VLAesfghSVFRDSLKR 390
gi 14530602 429 VMGdsfnsSLFKQTYQR 445
gi 4176521  372 VLSdsfttSIFKQSFQR 388
gi 7271162  376 VMGdsfnsSLFKQTFQR 392
gi 2244772  379 VLSesfghSVFKDSFKR 395
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap