Conserved Protein Domain Family
MYSc_type_XI

?
cd01384: MYSc_type_XI (this model, PSSM-Id:238680 is obsolete and has been replaced by 276835)
Myosin motor domain, plant-specific type XI myosin, involved in organelle transport. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle.
Statistics
?
PSSM-Id: 238680
View PSSM: cd01384
Aligned: 18 rows
Threshold Bit Score: 1117.44
Threshold Setting Gi: 1709211
Created: 1-Nov-2000
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
  next features
Feature 1:ATP-binding site [chemical binding site]
Evidence:
  • Comment:the residues of the P-loop wrap around the triphosphate region of the nucleotide and the N-terminal region forms the binding pocket for the nucleotide

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                 #### ##                                
gi 36956980   62 AGVDDMTKLAYLHEPGVLHNLACRYGINEIYTYTGNILIAVNPFRRLPhLYDVHMMEQYKGAAFGELSPHLFAIADACYR 141
gi 1709211    81 EGVDDLSFLSHLHEPAILHNLHHRYNLNQIYTYIGKILIAINPYTSLP-LYGKEMISAYYGKQLGTLAPHVYAVAEDAFK 159
gi 42567989   76 GGVDDMTKLSYLHEPGVLNNLAMRYELNEIYTYTGNILIAVNPFQRLPhLYDTHMMEQYKGAGFGELSPHVFAIAEVAYR 155
gi 15240028   62 SGVDDMTRLAYLHEPGVLQNLHSRYDINEIYTYTGSILIAVNPFRRLPhLYSSHMMAQYKGASLGELSPHPFAVADAAYR 141
gi 2129653    62 SGVDDMTRLAYLHEPGVLQNLHSRYDINEIYTYTGSILIAVNPFRRLPhLYSSHMMAQYKGASLGELSPHPFAVPDAAYR 141
gi 42569586   78 LGVDDMTKLAYLHEPGVLLNLKARYNANEIYTYTGNILIAVNPFKRLPhLYGNEIMEQYKGTDFGELSPHPFAVADSAYR 157
gi 8778462    76 GGVDDMTKLSYLHEPGVLRNLETRYELNEIYTYTGNILIAVNPFQRLPhIYETDMMEQYKGIALGELSPHVFAIGDAAYR 155
gi 31193918   40 GGVEDMTRLAYLHEPGVLQNLKSRYALNEIYTYTGNILIAVNPFQRLPhLYNNHMMGIYKGAEFGELGPHPFAIADRSYR 119
gi 25295729   72 SGVDDMTTLAYLHEPGVLQNLKSRYYIDEIYTYTGNILIAVNPFKQLPnLYNDHMMAQYKGAALGELSPHPFAVADAAYR 151
gi 7441405    45 SGAEDMTTLSYLHEPAVLWNLNTRYAYDDIYTYTGTILIAINPFAALPhLYGEHMMNQYRGVEIGDYAPHVYAIADAAYR 124
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                        ########                                                        
gi 36956980  142 AMINEQGSQSILVSGESGAGKTETTKMLMRYLAFMGGrsgt------------------------------egrtVEQQV 191
gi 1709211   160 DMRYDGTSQSILVSGESGAGKTETTKFLLQYLAAMGNmikestssssingintssdgipvtpppspmkkspvdksVEERV 239
gi 42567989  156 AMINEGKSNSILVSGESGAGKTETTKMLMRYLAYLGGrsgv------------------------------egrtVEQQV 205
gi 15240028  142 QMINDGVSQSILVSGESGAGKTESTKLLMRYLAYMGGraaa------------------------------egrsVEQKV 191
gi 2129653   142 QMINDGVSQSILVSGESGAGKTESTKLLMRYLAYMGGraaa------------------------------egrsVEQKV 191
gi 42569586  158 KMINEGVSQAILVSGESGAGKTESTKMLMQYLAYMGGkaes------------------------------egrsVEQQV 207
gi 8778462   156 AMINEGKNNSILVSGESGAGKTETTKMLMRYLAFLGGrsgvegrtve-------------------qqvlelnvyIPNGT 216
gi 31193918  120 LMINNRISQAILVSGESGAGKTESTKMLMQYLAFMGGkaqa------------------------------egrsVQQQI 169
gi 25295729  152 QMINEGISQSILVSGESGAGKTETAKMLMKYLAKMGGravs------------------------------drrtVEDQV 201
gi 7441405   125 QMRKEGKGQSILVSGESGAGKTETSKLIMKYLAYMGGytdagea-------------------------tgsgrsVEEQV 179
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 36956980  192 LESNPVLEAFGNAKTVKNNNSSRFGKFVEIQFDKYGKISGAAVRTYLLERSRVCQVSDPERNYHCFYMLCSA-PPEDV-K 269
gi 1709211   240 LESTPLLEAFGNAKTLRNDNSSRFGKFIEIHFNEMGSIIGAKILAYLLEKSGIVRQVYNERNYHIFYQLLSGaSEELK-E 318
gi 42567989  206 LESNPVLEAFGNAKTLRNNNSSRFGKFVELQFDNCGRISGAAVRTYLLERSRVCQISDPERNYHCFYLLCAA-PPEER-E 283
gi 15240028  192 LESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDEKGRISGAAIRTYLLERSRVCQVSDPERNYHCFYMLCAA-PQEDV-K 269
gi 2129653   192 LESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDEKGRISGAAIRTYLLERSRVCQVSDPERNYHCFYMLCAA-PQEDVkK 270
gi 42569586  208 LESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFNHMGRISGAAIRTYLLERSRVCQVSDPERNYHCFYMLCAA-PEQET-E 285
gi 8778462   217 LQSNPVLEAFGNAKTLRNNNSSRFGKFVEIQFDKNGRISGAAIRTYLLERSRVCQISDPERNYHCFYLLCAA-PPEDI-K 294
gi 31193918  170 LESNPVLEAFGNAKTVRNNNSSRFGKFVEIQFDDNGKISGAAIRTYLLERSRVCQISDPERNYHCFYMLCAA-PSEDC-K 247
gi 25295729  202 LESNPVLEAFGNAKTVKNNNSSRFGKFVEIQFDQRGRISGAAIRTYLLERSRVCQVSDPERNYHCFYMLCAA-PPEDK-R 279
gi 7441405   180 LESNPLLEAFGNAKTTRNNNSSRFGKYVEINFNDKGVISGAAIRTYLLERSRVVAINNPERNYHIFYQLTDGaSAEQRtQ 259
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 36956980  270 KFKVGdprsFHYLNQTNCYEVANVDDAREYLETRNAMDVVGIGQEEQDAIFRVVAAILHLGNINFSKGqe--iDSSKLRD 347
gi 1709211   319 KLNLKtieeYSYLNKSGCFEIEGVSDEEHFNKTCHAMQVAGITLVEQENVFRILSAILLIGNFEFENIagsndDSCQLID 398
gi 42567989  284 KFKLGdpklFHYLNQSKCYKLDGVDDTEEYLATRRAMDIVGISEEEQDAIFRVVAAILHLGNVNFAKGke--iDSSVLKD 361
gi 15240028  270 KFKLEepkkYHYLNQSKCLELDSINDAEEYHATRRAMDVVGISTEEQDAIFSVVAAILHIGNIEFAKGee--iDSSIPKD 347
gi 2129653   271 FKLEEpk-kYHYLNQSKCLELDSINDAEEYHATRRAMDVVGISTEEQDAIFSVVAAILHIGNIEFAKGee--iDSSISKD 347
gi 42569586  286 RYQLGkpstFHYLNQSNCHALDAIDDSKEYLATRKAMDVVGISPEEQDAIFRVVAAILHLGNIEFAKSee--sDGAEPKD 363
gi 8778462   295 KYKLEnphkFHYLNQSSCYKLDGVDDASEYLETRRAMDVVGISNEEQEAIFRVVAAILHLGNIDFGKGee--iDSSVIKD 372
gi 31193918  248 KYKLGeaktFHYLNQSNCIELDGLDDSKEYTDTRRAMSIVGISSDEQDAIFRVVAAILHLGNVEFAEGse--aDSSMPKD 325
gi 25295729  280 KLKLNdpteFRYLNQSHCIKLDGVDDSKEYTKTREAMGIVGINLEEQEAIFRVVAAILHLGNIEFAIGee--pDSSVPTD 357
gi 7441405   260 WRLKTaq-eYRYLNQSTCFQLPGTDNAEDFKRTIYAMERVGIPTADQDAIFRTVAAILHLGNIQFSAGp---eDSSLVTP 335
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 36956980  348 eksvyHLKIVAELLMCDe-KALQDSLCERVIVTPDGNITKPLDPDSAALSRDALAKTVYSRLFDWIVDKINNSIgqd--p 424
gi 1709211   399 r---dPLEKVSVLLGCAqpDELLNSMLTRKVVTGKESYISHNTKERAENARDSLSMFLYGMMFDWLVVKINSSMsistqq 475
gi 42567989  362 eksryHLDVCAELLRCDa-KKMEDALIKRVMVTPEEVITRTLDPDSATGSRDALAKTIYSRLFDWLVDKINNSIgqd--p 438
gi 15240028  348 dkslfHLKTAAELLSCDe-KALEDSLCKRIMVTRDETITKTLDPEAATLSRDALAKVMYSRLFDWLVDKINSSIgqd--h 424
gi 2129653   348 dkslfHLKTAAELLSCDe-KALEDSLCKRIMVTRDETITKTLDPEAATLSRDALAKVMYSRLFDWLVDKINSSIgqd--h 424
gi 42569586  364 dksrfHLKVAAKLFMCDe-KALENSLCNRVMVTRGESITKPLDPGSAALSRDALAKIVYSKLFDWLVTKINNSIgqd--s 440
gi 8778462   373 kdsrsHLNMAAELLMCNa-QSLEDALIRRVMVTPEEIITRTLDPDNAIASRDTLAKTIYSHLFDWIVNKINTSIgqd--p 449
gi 31193918  326 eksqfHLRTAAELFMCDe-KGLEESLCKRVMATRGESITKNLDPRAAALSRDALSRIVYSRLFDWLVNKINSSIgqd--p 402
gi 25295729  358 es-kkYLKIAAELFMCDe-QALEDSLCKRIMVTPEETISRCLDPNSAALSRDALAKFVYSRLFDWIVNKINNSIgqd--p 433
gi 7441405   336 at-edELDATAALLGVEk-EGLRKALTTRVRQTPEGPIVSPLDALAAGETRDSLAKIIYAKMFDWLVGMINSAIged--k 411
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 36956980  425 dATNIIGVLDIYGFESFKINSFEQLCINLTNEKLQQHFNQHVFKMEQEDYTREEIDWSYVEFVDNQDVLDLIEkkPGGII 504
gi 1709211   476 kSKSFIGVLDIYGFESFEVNGFEQFCINYANEKLQQLFNQHVFKEEQQEYIKEKIDWSYIDFNDNQDTLDLIEknPICIL 555
gi 42567989  439 nSKTIIGVLDIYGFESFKINSFEQFCINFTNEKLQQHFNQHVFKMEQEDYTKEEINWSYIEFVDNKDVLELIEkkPGGVI 518
gi 15240028  425 dSKYLIGVLDIYGFESFKTNSFEQFCINLTNEKLQQHFNQHVFKMEQEEYKKEEINWSYIEFVDNQDILDLIEkkPGGII 504
gi 2129653   425 dSKYLIGVLDIYGFESFKTNSFEQFCINLTNEKLQQHFNQHVFKMEQEEYKKEEINWSYIEFVDNQDILDLIEkkPGGII 504
gi 42569586  441 sSKYIIGVLDIYGFESFKTNSFEQFCINLTNEKLQQHFNQHVFKMEQEEYTKEEIDWSYIEFIDNQDVLDLIEkkPGGII 520
gi 8778462   450 rSKSIIGVLDIYGFESFKCNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYTKEEIAWSYIEFIDNQDVLELIEkkPGGII 529
gi 31193918  403 dSKILIGVLDIYGFESFKTNSFEQFCINLTNEKLQQHFNQHVFKMEQEEYTKEEIDWSYIQFVDNQEILDLIEkkPGGII 482
gi 25295729  434 dSKDMIGVLDIYGFESFKTNSFEQFCINLTNEKLQQHFTQHVLKMEQEEYTKEEIEWSQITFPDNRYVLELIEkkRGGII 513
gi 7441405   412 nCAASVGVLDIYGFEQFQYNDFEQFCINLANEKLQQHFNQHVFKMEQAEYEREQIDWSYIEFVDNQDVLDLIEg-KLGIL 490
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 36956980  505 ALLDEACMFPKSTHETFAQKMYQ--TYKAHKRFSKPKLARTAFTINHYAGDVTYQADQFLDKNKDYVVAEHQALLNSSRC 582
gi 1709211   556 TLLDEETMFPKATPQTLATKLYS--KMTSHSKFEKPRFSSTAFTINHYAGKVTYETDQFLDKNKDFIIPEQISILQRSNF 633
gi 42567989  519 ALLDEACMFPKSTHETFAQKLYQ--TFKNYKRFTKPKLSRTSFAISHYAGEVTYQADLFLDKNKDYVVAEHQDLLIASSD 596
gi 15240028  505 ALLDEACMFPRSTHETFAQKLYQ--TFKTHKRFTKPKLARSDFTICHYAGDVTYQTELFLDKNKDYVIAEHQALLNSSSC 582
gi 2129653   505 ALLDEACMFPRSTHETFAQKLYQ--TFKTHKRFTKPKLARSDFTICHYAGDVTYQTELFLDKNKDYVIAEHQALLNSSSC 582
gi 42569586  521 ALLDEACMFPRSTHDTLAEKLYQ--TFGSHKRFTKPKLARTDFTICHYAGDVTYQTELFLDKNKDYVVGEHQSLMNSSDC 598
gi 8778462   530 SLLDEACMFPKSTHETFSQKLFQ--TFKEHERFAKPKLSRTDFTISHYAGEVTYQSNHFIDKNKDYIVAEHQALFTASNC 607
gi 31193918  483 ALLDETCMLRNSTHETFAEKLYQ--KFKDNPHFSKPKFSRSDFTIHHYAGNVTYQTDLFLDKNIDYAVNEHQILLNASKC 560
gi 25295729  514 ALLDEACMFPRSTHKTFSQKLYE--TLKDNKYFSKPKLSRTDFTICHYAGDVTYQTEQFLEKNKDYVVAEHQALLGASRC 591
gi 7441405   491 DLLDEVCRFVEAKGKDFAEKLYTsgTCKDSRRFSKPKTSVTQFIIDHYAGPVKYDTANFLDKNKDFVVPEHQALLCASTQ 570
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 36956980  583 PFVANLFPPlpeet-----------------------skqsKFSSIGTRFKQQLQALMETLSTTEPHYIRCVKPNAVLKP 639
gi 1709211   634 SFIKVLMSHsdkftqspgghpqgnggptssntkgtsgsssmKFLSVGSQFSTSLATLMKTISTTTPHYVRCIKPNPEKLP 713
gi 42567989  597 TFVAGLFPRlpeet-----------------------ssktKFSSIGSRFKLQLQSLMETLSSTEPHYIRCVKPNNVLKP 653
gi 15240028  583 SFVASLFPPmsdd------------------------skqsKFSSIGTRFKQQLVSLLEILNTTEPHYIRCIKPNNLLKP 638
gi 2129653   583 SFVASLFPPmsdd------------------------skqsKFSSIGTRFKQQLVSLLEILNTTEPHYIRCIKPNNLLKP 638
gi 42569586  599 SFVSSLFPKsrees-----------------------skssKFSSIGSQFKQQLQSLLETLNTTEPHYIRCVKPNNVLKP 655
gi 8778462   608 KFVAGLFHAlheds-----------------------srssKFSSIGSRFKQQLHSLMESLNGTEPHYIRCIKPNNVLKP 664
gi 31193918  561 SFVSSLFPPcees------------------------tkstKFSSIGSSFKQQLQSLLETLSAIEPHYIRCIKPNNVLKP 616
gi 25295729  592 TFIAGLFPPlveda-----------------------nkqsKFSSIASQFKQQLASLIEGLNTTEPHYIRCVKPNNLLKP 648
gi 7441405   571 SFTAQLFAEaaadadsappa----------pgrrggatkgtKFNSVGSQFKKQLAELMVQLHAMEPHYIRCIKPNESAQP 640
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1                                                                                        
gi 36956980  640 GIFENFNVLNQLRCGGVLEAIRISCAGYPTKRTFDEFIDRFGMLAAELVdssdekaac---------------------- 697
gi 1709211   714 QTFNKQDVIHQLRCGGVMESVRICCAGFPTRRLLSEFYQRYKILYVKDIntgsgggkkgsnnnkik-------------- 779
gi 42567989  654 AIFENVNVIQQLRCGGVLEAIRISCAGYPTKRTFYEFLNRFGVLAPEVLegnyddkvac--------------------- 712
gi 15240028  639 GIFENENILQQLRCGGVMEAIRISCAGYPTRKHFDEFLARFGILAPEVLvknsddpaac--------------------- 697
gi 2129653   639 GIFENENILQQLRCGGVMEAIRISCAGYPTRKHFDEFLARFGILAPEVLvknsddpaac--------------------- 697
gi 42569586  656 EIFENVNVLHQLRCGGVMEAIRISCAGYPTRKPFNEFLTRFRILAPEATersfdevdac--------------------- 714
gi 8778462   665 GIFENFNVIHQLRCGGVLEAIRISCAGYPTRLAFYDFLDRFGLLAPEVLegnyddkvacqmildkksltdyqrhghdprw 744
gi 31193918  617 AIFENSNVLQQLRCGGVLEAIRISCLGYPTRRTFFEFINRFGILQPKVLgrshdevaat--------------------- 675
gi 25295729  649 SIFENQNSLQQLRCGGVMETIRVCRAGYPTRKHFDEFLDRFGILDSATLdkssdekaac--------------------- 707
gi 7441405   641 SVFENKNVLHQLKCGGVMEAVRISCAGFPSKRPYGEFVDHFWQLAPDLLktdaddkait--------------------- 699
                        730       740       750       760       770       780
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
Feature 1                                                                     
gi 36956980  698 ------------------------aaicdkmglKGYQIGKTKVFLRAGQMAELDARRAEVL 734
gi 1709211   780 ----------------dpkilvqnlltgielsdDKYKIGLTKVFLRAGQLASLEDMRLEQL 824
gi 42567989  713 ------------------------kmlldkiglKGYELGKTKVFLRAGQMAELDARRAEVL 749
gi 15240028  698 ------------------------kklldkvglEGYQIGKTKVFLRAGQMADLDTRRTEVL 734
gi 2129653   698 ------------------------kklldkvglEGYQIGKTKVFLRAGQMADLDTRRTEVL 734
gi 42569586  715 ------------------------kkllarvdlKGFQIGKTKVFLRAGQMAELDAHRAEVL 751
gi 8778462   745 dhpqekkislpcsiiltigifsicsciiyvplpCCSQIGKTKIFLRAGQMAELDARRAEVL 805
gi 31193918  676 ------------------------kmllgkanlTGYQIGKTKVFLRAGQMAELDALRTEIL 712
gi 25295729  708 ------------------------kklletvglNGFQIGKTKVFLKAGQMAELDDRRTEVL 744
gi 7441405   700 ------------------------kailaktnvGGYQLGLSKVFMRAGQMAQLDKMRTDTL 736

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap