1PDN,6PAX


Conserved Protein Domain Family
PAX

?
cd00131: PAX 
Click on image for an interactive view with Cn3D
Paired Box domain
Statistics
?
PSSM-Id: 238076
View PSSM: cd00131
Aligned: 8 rows
Threshold Bit Score: 222.294
Threshold Setting Gi: 2506537
Created: 1-Nov-2000
Updated: 17-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
 
DNA binding
Conserved site includes 34 residues -Click on image for an interactive view with Cn3D
Feature 1:DNA binding site [nucleic acid binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
Feature 1            ##    # ### #    #           # #        #  # ##   #        ####### ## ##   
1PDN_C        1 GQGRVNQLGGVFINGRPLPNNIRLKIVEMAADGIRPCVISRQLRVSHGCVSKILNRYQETGSIRPGVIGGSKPR-IATPE 79
6PAX_A        1 XHSGVNQLGGVFVNGRPLPDSTRQRIVELAHSGARPCDISRILQVSNGCVSKILGRYYATGSIRPRAIGGSKPR-VATPE 79
gi 12643442   4 TYGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGSKPR-VTTPN 82
gi 4107113    8 GQGGVNQLGGLFVNGRPLPESIRRKIVELSQNGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPK-VATSK 86
gi 4185914   20 GHSGINQLGGIFVNGRPLPDVTRQRIIELSQSGARPCDISRILQVSNGCVSKILCRYYETGSIKPKAIGGSKPR-VATNT 98
gi 7595813    8 GQGKVNQLGGVFINGRPLPKLLRWKIIELAQMGVRPCDISRQLRVSHGCVSKILCRYQETGTVDPGIVGLNRPR-DVTPE 86
gi 2506537    5 GQAGVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTRFYETGSIRPGSIGGSKTKqVATPT 84
gi 17533499  13 GQGRVNQLGGVFINGRPLPIHVRHAIISMAKKGIKPCHISRQLKVSHGAVSKILNRYAETGSISPGQIGGSPRArLTVQA 92
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*....
Feature 1                      ###                  # ##  #  #   
1PDN_C       80 IENRIEEYKRSSPGMFSWEIREKLIREGVCDRSTAPSVSAISRLVRGRD 128
6PAX_A       80 VVSKIAQYKQECPSIFAWEIRDRLLSEGVCTNDNIPSVSSINRVLRNLA 128
gi 12643442  83 VVKHIRDYKQGDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKI 131
gi 4107113   87 VVLKIEDYKQENPSIFAWEIRDRLLQDGVCDKVNVPSVSSINRIVRTRA 135
gi 4185914   99 VVRKVTIYKQESPSMFAWEIRDRPLQDGVCNQDNLPSISSINRILRSLA 147
gi 7595813   87 IENKIDQFRKENSGIFSWEVRDRLLRENICSKSTVPSLGAISQILKSKI 135
gi 2506537   85 VVKKIIRLKEENSGMFAWEIREQLQQQRVCDPSSVPSISSINRILRNSG 133
gi 17533499  93 VEKEILIACDENPQMSAAELRDWLIHKDICTKGNAPTVPAIKRLIGNKG 141

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap