Conserved Protein Domain Family
PRK13197

?
PRK13197: PRK13197 
pyrrolidone-carboxylate peptidase; Provisional
Statistics
?
PSSM-Id: 237299
View PSSM: PRK13197
Aligned: 152 rows
Threshold Bit Score: 285.994
Threshold Setting Gi: 169827670
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PRK13197 is a member of the superfamily cl00237.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37528134    1 MKTVLITAFEPFDGEAINPSWESVRQLQNQQLSGAHIETRQLPCVFNTSLTCLYAAIDEIQPELVIAVGQAGGRPDITVE 80
gi 156976663   1 MKKVLMTGFEPFGGESINPALEAVKRLDGKKLDGGEVMICQVPVTRYESIDTVVNAIEQYQPDIVITVGQAAGRAAITPE 80
gi 37675745    1 MRKVLLTGFEPFGGESINPSLELVKQMASRALPQVEIIGCEVPVVRYQAIETVLQAVETHQPDLVLMIGQASGRCAITPE 80
gi 27367634    1 MRKVLLTGFEPFGGESINPSLELVKQMASRALPQVEIIGCEVPVVRYQAIETVLQAVETHQPDLVLMIGQASGRCAITPE 80
gi 15616193    2 GNIILLTGFQPFLDYSINPTEAIVKELNGRKIGEYEVRGVILPVSFRESGDLLLHHFQTVQPTAVFMLGLAAGRGKITPE 81
gi 169827670   1 MTKILLTGFEPFLDYKLNPTMQIVENLDGEKIENYHIIGRILSVDFQQSAEQLKRHIEEIEPQIIISLGLAGGRFKITPE 80
gi 197334675   1 MKKILITGFEPFGNDKINPALEAVKLIAGRKLNGGEIVICQVPVVRYKSIETVKQAIEEQQPYAVITVGQASGRAAITPE 80
gi 261420122   1 MKKLLLTGFEPFLEFPINPTERIVRELDGKGIGKYWVYGRVLPVDFSQSSLCCLEYLEQIQPDVVMSLGLAAERTKITPE 80
gi 288554161   1 MKTILVTGFEPFLDHEDNPTRKIAAAIDGEVIGEYKVKAAVLPVTFSGAAGKVKEKIEEINPDAVIMLGLAAGRNRITPE 80
gi 59711977    1 MKKILITGFEPFGNDKINPALEAVKLIAGRKLNGGEIVICQVPVVRYKSIETVKQAIEEQQPYAVITVGQASGRAAITPE 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 37528134   81 RIAININDARIPDNQGNQPIDTPIVATGPAAYFSTLPIKAIVSGLQTAGVPASISQSAGTYICNHVMYGLLHHLALTy-P 159
gi 156976663  81 RVAINVDDFRIPDNGGHQPIDEPVILDGPDAYFTTLPIKAITSALHKASIPCQVSNTAGTFVCNHLFYGIQHYLRDK--- 157
gi 37675745   81 RVAINLDDYRIEDNAGHQPVDEPIIATGPAAYFSTLPVKAITHALQQAGIPCQISHSAGTFVCNHLFYGVQHHLHTR--- 157
gi 27367634   81 RVAINLDDYRIEDNAGHQPVDEPIIATGPAAYFSTLPVKAITHALQQAGIPCQLSHSAGTFVCNHLFYGVQHHLHTR--- 157
gi 15616193   82 RVAININSGP-EDRDGIAPVDEPIRQGGPAAYFSTLPVRRLIQRLNEEGFPAEMSNSAGTYVCNHVMYRMLDYLHEKgsE 160
gi 169827670  81 RIAINIKDGE-PDNNGYSPVDESIQEEGADAYLTNLPIRHMINRLQEEGYPAEISNTAGTYLCNNIMYEGLVYAQQH--E 157
gi 197334675  81 RIAINVDDFRIPDNEGIQVIDEPVVAGGPDAYFTTLPIKAMVSEIQAQGIPATVSNTAGTFVCNHLFYGIQHYLKDT--- 157
gi 261420122  81 RVAINCQDGG-PDNRGMRVQDDLIVEDGPAAYFSTLPIRRLVNVLNERGYPAQISNTAGTYLCNHVMYSVLHKVSTEn-L 158
gi 288554161  81 RVAINCNDGEV-DNDGVKKQDEEIVEGGPAAYFSTLPIRPFVDRLTGAGIPAAISNTAGTYVCNNIMYQTLHYLGERg-L 158
gi 59711977   81 RIAINVDDFRIPDNEGIQVIDEPVVAGGPDAYFTTLPIKAMVSEIQAQGIPATVSNTAGTFVCNHLFYGIQHYLKDT--- 157
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 37528134  160 KvrgglVRGGFIHIPYLPEQAVKHPGTPSMALETITMALKIAINQALENSGDIAISGGMTH 220
gi 156976663 158 S-----VRHGFVHIPLLPEQDASG-NQPTMSLDLIVEGLALLAQAVIDNESDVAITAGQIC 212
gi 37675745  158 A-----IRSGFIHIPLLPEQA-SASNQPSMSLETLVHGLEMMMITCLETEQDTKHTGGTIC 212
gi 27367634  158 A-----IRSGFIHIPLLPEQA-SASNQPSMSLETLVHGLEMMMMTCLETEQDTKHTGGTIC 212
gi 15616193  161 Q-----VAAGFVHLPASKELAAQHHSLPSMDLKDLTRAVTLMIEEL--------------- 201
gi 169827670 158 G-----VRAGFIHIPASFELAIQHGKIPGWHIRDLIAAVKLCIEETVRAGNh--------- 204
gi 197334675 158 N-----VRHGFVHIPLLPEQSVDG-SQPTMKLEQIAEGLAIAAQAIIDNDSDIQQGAGTIC 212
gi 261420122 159 S-----VQAGFVHLPASHELAVQRPTFPSWSYKDLRDAVMLMIEELE-------------- 200
gi 288554161 159 S-----IPAGFVHVPASHQMALTKPSLPSMSEEEMLRAMQVMIEAM--------------- 199
gi 59711977  158 N-----VRHGFVHIPLLPEQSVDG-SQPTMKLEQIAEGLAIAAQAIIDNDSDIQQGAGTIC 212
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap