Conserved Protein Domain Family
PRK11192

?
PRK11192: PRK11192 
ATP-dependent RNA helicase SrmB; Provisional
Statistics
?
PSSM-Id: 236877
View PSSM: PRK11192
Aligned: 153 rows
Threshold Bit Score: 627.74
Threshold Setting Gi: 56461231
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119775874   1 MLFEDFQLDPELLESLKAMGHNTPTTIQRMTIPLAMEQRDILARAPTGTGKTASFLLPALQHLIDFPRRRPGQPRVLVLT 80
gi 127511701  14 MQFEDFHLDDTLLESLKAMGHLAPTTIQQQTIPLALEHKDILARAPTGTGKTASFLLPALQHLLDFPRRYSGQARVLILA 93
gi 77359468    1 MQFSEFDLDNKLLDAINKMGYETPTSIQQQAIPEALQGRDILASAPTGTGKTAAFLIPAIQYLLDFPRRDPGFARVLVMT 80
gi 212636948   4 MLFEDLQLDPCLLESLKAMGHNKPTTIQQQTIPVAMEQRDILARAPTGTGKTASFLLPALQHIIDFPRRFGGQARVLVLT 83
gi 167622797   4 MQFEDLQLDPRLLESLKAMGHNKPTTIQQQTIPVAMEQRDILARAPTGTGKTASFLLPALQHLLDFPRRYGGRARVLILT 83
gi 161407972   1 -MFEQFDLDSELLASINKIGYTKPTSIQELVIPQAMVGKDVLASAPTGTGKTAAFLLPIAQHLLDYPRTKPGFPRVLILT 79
gi 109899589   1 -MFEQLELDDELCRAVADLGYSEPTSIQQLVIPAAMEGKDILASAPTGTGKTAAFLLPVCQFLLDYPRRHPGSTRILILT 79
gi 196157892   1 MTFEELELDDALCHAAADMGFEAPTNIQELVIPHALDGRDILASAPTGTGKTAAFLLPACQFLLDYPRKQPGATRILILT 80
gi 170725255   1 MLFEDLLLDPILLESLKAMGHHKPTTIQQQTIPLAMDQRDILARAPTGTGKTASFLLPALQHIIDFPRRFSGQARVVILT 80
gi 157960630   4 MQFEDLQLDPCLLESLKAMGHNKPTTIQQQTIPVAMEQRDILARAPTGTGKTASFLLPALQHLIDFPRRYGGRARVLILT 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119775874  81 PTRELASQIHRYASHLATNLELDIKLITGGVPYGPQEEMLKSNVDILVATPGRLLEYLDKGHFSAELVEVLVIDEADRML 160
gi 127511701  94 PTRELASQVHRYASHLATGLGLDIAIITGGVPYAPQEQALKENIDILVATPGRLMEYLDKELFDAQSVEILVLDEADRML 173
gi 77359468   81 PTRELAYQIHEQCELLAKRTNLKIGVVTGGINYGTHKEIFEKNNDILIATPGRLMEYLETENFHAEHVEMLIIDEADRML 160
gi 212636948  84 PTRELASQIHRYASHLATDLDLDISIITGGVPYAPQEEALKKNVDILVATPGRLMEYLDKGLFNAEEVEVLVIDEADRML 163
gi 167622797  84 PTRELASQIHRYASHLATGLGLDTVIITGGVPYGPQEEALQKNVDILVATPGRLMEYLDKGHFNAEEVEVLIIDEADRML 163
gi 161407972  80 PTRELAIQIGEDSEQLTELTKIKTGVITGGVNYGSHADILTSTTDILVATPGRLLEYIENEQFDAREIEILVLDEADRML 159
gi 109899589  80 PTRELAQQVYNQALELSRYTDIVCGVITGGINYGTDRDTFEKNLDILVATPGRLFEHIEQESFDCRDIECLILDEADRML 159
gi 196157892  81 PTRELALQVYEQAVAITKHTQLVCGVITGGINYGTDKETLSKNLDILVATPGRLLEHIEKEAADCRDIECLILDEADRML 160
gi 170725255  81 PTRELASQIHRYASHLAYELDLNTVIITGGVPYAPQEEALKGNVDILVATPGRLMEYLDKGLFNAEEVEILVIDEADRML 160
gi 157960630  84 PTRELASQIHRYASHLATGLGLDTVIITGGVPYGPQEEALQKNVDILVATPGRLMEYLDKGHFNAEEVEVLIIDEADRML 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119775874 161 DMGFGEVVKTIAVEASGRKQAMLFSATLEGGGVGSFARELLNEPMFVESEPPRSEKAKIHQWIHLADDKDHKFALLTHLL 240
gi 127511701 174 DMGFSSAVQSIAIEAQQRKHNMLFSATLEGGGVSRFAEMLLTNPVTIETKPPRSEKAKIHQWMHLADDKEHKFALLCDIL 253
gi 77359468  161 DMGFKKEMSRICDEAKNRRQCFLFSATLEGDSVERFAETTLNDPALLEAESSRKEKAKIHQWVHLADDYHHKLELLVNTL 240
gi 212636948 164 DMGFSAVVETIAIESVGRKQTMLFSATLEGSDVGRFSHQLLSNPVKLEAEAPRSEKAKIHQWVHIADDREHKFALLYAIL 243
gi 167622797 164 DMGFSAVVETIAIESVGRKQTMLFSATLEGSDVGRFSHELLTNPVKLEAEAPRSEKAKIHQWIHLADDKAHKFALLCALL 243
gi 161407972 160 DLGFSETINRIVAEARWRKQTMLFSATLESPGVQLFAEEVLNEPVFLESKPSRKEKAVIHQWLHLADDANHKLNLLVNTL 239
gi 109899589 160 DMGFSSIVNQISAEARWRKQSMLFSATLEGTGISRFAKDILNDPVELEAASSRKEQGKIHQWLHIADDAKHKYALLKHIL 239
gi 196157892 161 DMGFSTVVNQIAAEARWRKQNLLFSATLEGKGVKTFAHDILNNPEIVEANPSRKEKNKIHQWYHLADDMNHKQALLVNIL 240
gi 170725255 161 DMGFSAVVETIAIESVGRKQTMLFSATLEGSDVGRFSHQLLTDPVKVEAEAPRSEKAKIHQWIHIADDKEHKFKLLCSIL 240
gi 157960630 164 DMGFSAVVESIAIESVGRKQTMLFSATLEGSDVGRFSHNLLTNPVKLEAEAPRSEKAKIHQWIHLADDKAHKFALLCALL 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119775874 241 KQeEVKRAIVFCKTRDVVASLEGQLQQAGIACAFMRGDMDQKKRFQALGRFTKGEVNVLLATDVAARGIDIEDITHVINF 320
gi 127511701 254 KReEVSRAIVFVKTREVVASLEGQLQQAGIHCAFMRGDMEQKARFQALGRFTKGEVNVLLATDVAARGIDIDGITHVINF 333
gi 77359468  241 NGpDVTKAIVFVKTRERLETLIGELTTNDVKAAWLRGEMPQDKRMKAMENFHSGKTRILVATDVAARGIDVADISHVINF 320
gi 212636948 244 QQeEVERAIVFVKTREAVASLDGLLQKQGITCSFMRGDMEQKARFQALGRFTKGEVNVLLATDVAARGIDVDDITHVINF 323
gi 167622797 244 KQeEVQRTIVFVKTREAVASLEGLLQKEGITCAFMRGDMEQKARFQALGRFTKGEVNILLATDVAARGIDIDDITHVINF 323
gi 161407972 240 KQeGVERTVVFANKRETVQYLSGKLYAEELPCVWLEGKMPQDKRNKAIERFKKGEVKVLVATDVAARGLDIDDISHVINF 319
gi 109899589 240 TH-QVESAVVFVKTRDRLNELKQILERDGFTVCWLQGEMPQDKRNLSMAKFRSGEVKILIATDVAARGIDVESISHVINY 318
gi 196157892 241 KQeTTTSAVVFVKTRDRLQMLKDFLASQDIQVCWLQGEMPQDKRNAAMARFKNGEVPILLATDVAARGIDVPNVSHVINF 320
gi 170725255 241 QQeETQRAIVFVKTREAVASLEGMLQRVGIPCSYMRGDMEQKQRFQALGRFTKGEVNVLLATDVAARGIDVEDITHVINF 320
gi 157960630 244 KQeEVQRTIVFVKTRESVASLEGLLQKEGITCAFMRGDMEQKARFQALGRFTKGEVNILLATDVAARGIDIDDITHVINF 323
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119775874 321 DMPRSADTYVHRIGRTGRAGAKGTAISLVEAHDMRILGKVERYIEQPLKRRVIEELRPKHKeAkvPTKKKVKAKDAKAKA 400
gi 127511701 334 DMPRSADTYVHRIGRTGRAGNKGTAISLVEAHDMRVVAKIERYIEQPLKRRVIDSLRPKHK-E----------------- 395
gi 77359468  321 DLPRTADIYVHRIGRTGRAGKKGIAISLVEAHDIGILYKIERYIEQKLKRRVIKGLEPKHK-EakPPAKKRKDP------ 393
gi 212636948 324 DMPRSADTYVHRIGRTGRAGAKGTAISLVEAHDIRVVGKIERYIEQPLKRRFIKDLRPKNK-EakPPGKKKVKDTGKTFS 402
gi 167622797 324 DMPRSADTYVHRIGRTGRAGAKGTAISLVEAHDIRVVGKIERYIEQPLKRRFVKDLRPKNK-E----------------- 385
gi 161407972 320 DMPRKVDIYIHRIGRTGRAGKKGTAISLVEAHDMGVIGKIERYTKERLSRRFIQELRPKNK----ESRVVNKKAKIKLTT 395
gi 109899589 319 DMPRTADVYVHRIGRTGRAGNKGTAISLVEAHDIGIVPKIERYTEQPLKRRVIDELRPKNKeAkpPAKRKISNKAKKAAG 398
gi 196157892 321 DMPRKADIYVHRIGRTGRAGAKGTAISLVEAHDFEMVTKAARYMGEPLKARVIDELRPKNK-T--PKIGPKK-------- 389
gi 170725255 321 DMPRSADTYVHRIGRTGRAGAKGTAISLVEAHDIRVVGKIERYMDQPLKRRFIKDLRPKNK-EakPPGKNKVKPSEKSFS 399
gi 157960630 324 DMPRSADTYVHRIGRTGRAGAKGTAISLVEAHDIRVVGKIERYIEQPLKRRFVKDLRPKNK-EakPPGKKKPGPEGKNFS 402
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 119775874 401 KNAKpkaapgrgpatpnaktadsrggdnvrsggrastrrtgtdekgdgldkherrghdkqerrshdkgdtgrsqhgarer 480
gi 127511701     --------------------------------------------------------------------------------
gi 77359468      --------------------------------------------------------------------------------
gi 212636948 403 K------------------------------------------------------------------------------- 403
gi 167622797     --------------------------------------------------------------------------------
gi 161407972 396 SQ------------------------------------------------------------------------------ 397
gi 109899589 399 IPLK---------------------------------------------------------------------------- 402
gi 196157892     --------------------------------------------------------------------------------
gi 170725255 400 KK------------------------------------------------------------------------------ 401
gi 157960630 403 KK------------------------------------------------------------------------------ 404
                        490       500       510
                 ....*....|....*....|....*....|....*...
gi 119775874 481 tegqsyasrdgnprgaKREVGEKtpHSRSDKRHQDTDR 518
gi 127511701 396 ----------------AKVPTKK--KVKSSDKKSPKKA 415
gi 77359468  394 ----------------VKMKAKK--KAKVKKKK----- 408
gi 212636948 404 ----------------KNKKKKK--------------- 410
gi 167622797 386 ----------------AKPPGKK--KPGPEGKNFSKKN 405
gi 161407972 398 ----------------KKAKTKK--QVKKKAKRAKAAK 417
gi 109899589 403 ----------------KKAKKKK------------NRG 412
gi 196157892 390 ----------------KKVKAKD--KTKAKAKPKKKK- 408
gi 170725255 402 ----------------NKKKKKK--------------- 408
gi 157960630 405 ----------------NKKKKKK--------------- 411
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap