Conserved Protein Domain Family
fliD

?
PRK08032: fliD 
flagellar capping protein; Reviewed
Statistics
?
PSSM-Id: 236141
View PSSM: PRK08032
Aligned: 77 rows
Threshold Bit Score: 542.743
Threshold Setting Gi: 188533565
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

PRK08032 is classified as a model that may span more than one domain.
PRK08032 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 290475009   1 MASISSLGAGSGMDLGSILDKLQAAERKRLEPLAQQQTSYKAKLTGFGTLKGSLEKLKSASEELKKFDKL---------- 70
gi 253688948   1 MASISSLGVGSGLPLDSLLTQLKTAENQKLVPITTQQSSFKAQLSGISALKSALDKLKTANDALAISESFgivkgsidgi 80
gi 108812443   1 MASISALGTGSGLDLNTLLSQLSAAEQTRLTPLTTQQTSYKSKLTAYGVLQSALAKLETASTALKKADTL---------- 70
gi 145598573   1 MASISALGTGSGLDLNTLLSQLSAAEQTRLTPLTTQQTSYKSKLTAYGVLQSALAKLETASTALKKADTL---------- 70
gi 294503996   1 MASISALGTGSGLDLNTLLSQLSAAEQTRLTPLTTQQTSYKSKLTAYGVLQSALAKLETASTALKKADTL---------- 70
gi 51596048    1 MASISALGTGSGLDLNTLLSQLSAAEQTRLTPLTTQQTSYKSKLTAYGVLQSALAKLETASTALKKADTL---------- 70
gi 153948368   1 MASISALGTGSGMDLNTLLSQLSAAEQTRLTPLTTQQTSYKGKLTAYGVLQSALAKLETASTALKKADTL---------- 70
gi 170024607   1 MASISALGTGSGLDLNTLLSQLSAAEQTRLTPLTTQQTSYKSKLTAYGVLQSALAKLETASTALKKADTL---------- 70
gi 186895153   1 MASISALGTGSGLDLNTLLSQLSAAEQTRLTPLTTQQTSYKSKLTAYGVLQSALAKLETASTALKKADTL---------- 70
gi 123442754   1 MASISSLGVGSGMELSSLLTSLSNAEQARLTPLTTQQTSYKSKLTAYGILQSALAKVETASAALKKADTL---------- 70
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 290475009  71 NTTKVSEDHKTFTPTTDSKASPGNYIIEINQLAKAQSLQSPAVSDVKFPQGEKlgEGktrTIVITQPGEE---------K 141
gi 253688948  81 TSTKVSSTNKAFSTTTDSKAVAGTYSIDVKQLAQAHSITSTAKTSATEPLSTT--DT---KLVISQDNGKftkvgddylK 155
gi 108812443  71 NSTAVSGSNSAFSATTDSAASAGTYSIEVTNLAKAQSLLSADVPSATDKLGSS--DAt-rTITITQPGQK---------E 138
gi 145598573  71 NSTAVSGSNSAFSATTDSAASAGTYSIEVTNLAKAQSLLSADVPSATDKLGSS--DAt-rTITITQPGQK---------E 138
gi 294503996  71 NSTAVSGSNSAFSATTDSAASAGTYSIEVTNLAKAQSLLSADVPSATDKLGSS--DAt-rTITITQPGQK---------E 138
gi 51596048   71 NSTAVSGSNSAFSATTDSAASAGTYSIEVTNLAKAQSLLSTDVPSATDKLGSS--DAt-rTITIAQPGQK---------E 138
gi 153948368  71 NSTAVSGSNSAFSATTDSAASAGTYSIEVTNLAKAQSLLSTDVPSATDKLGSS--DAt-rTITIAQPGQK---------E 138
gi 170024607  71 NSTAVSGSNSAFSATTDSAASAGTYSIEVTNLAKAQSLLSTDVPSATDKLGSS--DAt-rTITIAQPGQK---------E 138
gi 186895153  71 NSTAVSGSNSAFSATTDSAASAGTYSIEVTNLAKAQSLLSTDVPSATDKLGSS--DAt-rTITIAQPGQK---------E 138
gi 123442754  71 TSTAVSSTNTAFSAVTDSAASAGSYTIEVTNLAKSQSLLSAEVPDATNKLGN---DNasrTITITQPGKK---------D 138
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 290475009 142 PLRISLKDDETSLIEIRDAINKQEGNVNASIIKAtdnkdnkdnkGENKNYLILTSKKAGIQSVMTIKVEGDDKLSKWLNY 221
gi 253688948 156 YLEIDIKAGETSLNDVRDAINKVNGTVTASVVKA----------KDNEYYLMLTAKNSGTESKISIGGDDTSVFNG---- 221
gi 108812443 139 PMKISLTSEQTSLTGIRDAINKQEGSVNASIMKA----------DDNTYYLALTSKDTGTQSEMTISVAGDETLNNFLNY 208
gi 145598573 139 PMKISLTSEQTSLTGIRDAINKQEGSVNASIMKA----------DDNTYYLALTSKDTGTQSEMTISVAGDETLNNFLNY 208
gi 294503996 139 PMKISLTSEQTSLTGIRDAINKQEGSVNASIMKA----------DDNTYYLALTSKDTGTQSEMTISVAGDETLNNFLNY 208
gi 51596048  139 PMKISLTSEQTSLTGIRDAINKQEGSVNASIMKA----------DDNTYYLALTSKDTGTQSEMTISVAGDETLNNFLNY 208
gi 153948368 139 PMKISLTSEQTSLTGIRDAINKQEGSVNASIMKA----------DDNTYYLALTSKDTGTQSEMTISVAGDETLNNFLNY 208
gi 170024607 139 PMKISLTSEQTSLTGIRDAINKQEGSVNASIMKA----------DDNTYYLALTSKDTGTQSEMTISVAGDETLNNFLNY 208
gi 186895153 139 PMKISLTSEQTSLTGIRDAINKQEGSVNASIMKA----------DDNTYYLALTSKDTGTQSEMTISVAGDETLNNFLNY 208
gi 123442754 139 PLEVTLTSDQTSLTGIRDAINKQEGGVSASIMKA----------DDNTYYLALTSKDTGTQSEMTISVTGDDTLNDFLNY 208
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 290475009 222 TSGsesvpksGSGAMTQTVEAADAKLKVNGIEIERQTNEIKDAPEGITLNLKKLTEKDEsgkpkpeTLVVSRDIEPTKEA 301
gi 253688948 222 -------------TPTEKVAAKNAQITANGIEIERQSNAISDAFEGVTINLLAQTETGKp-----eTLTIEQDITGMKDT 283
gi 108812443 209 TPSst----gGSGALTQKVKAEDATLSVNGVSITRQSNTITDAPQGVTINLKAVTKEGAp-----eQLTIVRDNTATKAA 279
gi 145598573 209 TPSst----gGSGALTQKVKAEDATLSVNGVSITRQSNTITDAPQGVTINLKAVTKEGAp-----eQLTIVRDNTATKAA 279
gi 294503996 209 TPSst----gGSGALTQKVKAEDATLSVNGVSITRQSNTITDAPQGVTINLKAVTKEGAp-----eQLTIVRDNTATKAA 279
gi 51596048  209 TPSst----gGSGALTQKVKAEDATLSVNGVSITRQSNTITDAPQGVTINLKAVTKEGAp-----eQLTIVRDNTATKAA 279
gi 153948368 209 TPSst----gGSGALTQKVKAEDATLSVNGVSITRQSNTITDAPQGVTINLKAVTKEGAp-----eQLTIVRDNTATKAA 279
gi 170024607 209 TPSst----gGSGALTQKVKAEDATLSVNGVSITRQSNTITDAPQGVTINLKAVTKEGAp-----eQLTIVRDNTATKAA 279
gi 186895153 209 TPSst----gGSGALTQKVKAEDATLSVNGVSITRQSNTITDAPQGVTINLKAVTKEGAp-----eQLTIVRDNTATKAA 279
gi 123442754 209 TPSst----gGSGGMTQKVAAEDAALTINGVAITRQSNTITDAPQGVTLTLKAKTKTSEp-----eTLNITRDSTAMKTA 279
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 290475009 302 IKKWVEAYNGVQTTFESLTKFKPVAKGESASKDNGALLGDGTLKSIQSQLRHQIFSPQD-VADIATLNKLGIKQK-LDGT 379
gi 253688948 284 IKAWVDAYNALQDTISAQTKYTAVEAGESQVSSNGALLGDSTVRGIQSKLKAQLTTVQSgGDEFRILADLGITQNfKTGK 363
gi 108812443 280 IQSFVDAYNSLQTTFGSLTKYTVVETGQDQSTSNGALVGDGTLRSIQTQLKSQLASSQS--GDLKTLASIGITQD-LDGK 356
gi 145598573 280 IQSFVDAYNSLQTTFGSLTKYTVVETGQDQSTSNGALVGDGTLRSIQTQLKSQLASSQS--GDLKTLASIGITQD-LDGK 356
gi 294503996 280 IQSFVDAYNSLQTTFGSLTKYTVVETGQDQSTSNGALVGDGTLRSIQTQLKSQLASSQS--GDLKTLASIGITQD-LDGK 356
gi 51596048  280 IQSFVDAYNSLQTTFGSLTKYTVVETGQDQSTSNGALVGDGTLRSIQTQLKSQLASSQS--GDLKTLASIGITQD-LDGK 356
gi 153948368 280 IQSFVDAYNSLQTTFGSLTKYTVVETGQDQSTSNGALVGDGTLRSIQTQLKSQLASSQS--GDLKTLASIGITQD-LDGK 356
gi 170024607 280 IQSFVDAYNSLQTTFGSLTKYTVVETGQDQSTSNGALVGDGTLRSIQTQLKSQLASSQS--GDLKTLASIGITQD-LDGK 356
gi 186895153 280 IQSFVDAYNSLQTTFGSLTKYTVVETGQDQSTSNGALVGDGTLRSIQTQLKSQLASSQS--GDLKTLASIGITQD-LDGK 356
gi 123442754 280 IQTWVDAYNSLQTTFGSLTQYTAVEQGKDQSTNNGALVGDGTLRSIQTQLKSQLASAQP--GDVKTLASLGITQD-IKGK 356
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 290475009 380 LEISNEKLEKNLKEKPANVKAFFMGDGEKTGFATQTYNILKQTLDSHeGTIATATEGINKRLKTLERQVEQTNKNIDATI 459
gi 253688948 364 LEISDTKLEKALKEEPGRVRDFFVGDNDKTGFATQTRTYLKEVLDTSeGLIKTKEDGINSSLKKLDTQAARVQDAIESTI 443
gi 108812443 357 LVINADKLNTALTDKPNSVTAFFVGDGETTGFATQTEKLLNTALDTTlGTLKTATDGINTSLKNLDKQIAATTASIETAI 436
gi 145598573 357 LVINADKLNTALTDKPNSVTAFFVGDGETTGFATQTEKLLNTALDTTlGTLKTATDGINTSLKNLDKQIAATTASIETAI 436
gi 294503996 357 LVINADKLNTALTDKPNSVTAFFVGDGETTGFATQTEKLLNTALDTTlGTLKTATDGINTSLKNLDKQIAATTASIETAI 436
gi 51596048  357 LVIDADKLNTALTDKPNSVTAFFVGDGETTGFATQTEKLLNTALDTTlGTLKTATDGINTSLKNLDKQIAATTASIETAI 436
gi 153948368 357 LVIDADKLNTALTDKPNSVTAFFVGDGETTGFATQTEKLLNTALDTTlGTLKTATDGINTSLKNLDKQIAATTASIETAI 436
gi 170024607 357 LVIDADKLNTALTDKPNSVTAFFVGDGETTGFATQTEKLLNTALDTTlGTLKTATDGINTSLKNLDKQIAATTASIETAI 436
gi 186895153 357 LVIDADKLNTALTDKPNSVTAFFVGDGETTGFATQTEKLLNTALDTTlGTLKTATDGINTSLKNLDKQIAATTASIETAI 436
gi 123442754 357 LTIDSTKLDKALTEKPNGVVAFFVGDGKETGFATQTDNLLNTVLDTTkGTLKSATDGINKSLKNLDTQVTATTASIALTI 436
                        490       500
                 ....*....|....*....|....*....
gi 290475009 460 ERYKRQFTELDKLVNSLKSTSSSLFQLLR 488
gi 253688948 444 AIYQKQFVDLDKAMTDMNSTMSRLTSMFS 472
gi 108812443 437 ERYKTQFTQLDKLMTSMNSTASFLTQQFD 465
gi 145598573 437 ERYKTQFTQLDKLMTSMNSTASFLTQQFD 465
gi 294503996 437 ERYKTQFTQLDKLMTSMNSTASFLTQQFD 465
gi 51596048  437 ERYKTQFTQLDKLMTSMNSTASFLTQQFE 465
gi 153948368 437 ERYKTQFTQLDKLMTSMNSTASFLTQQFE 465
gi 170024607 437 ERYKTQFTQLDKLMTSMNSTASFLTQQFE 465
gi 186895153 437 ERYKTQFTQLDKLMTSMNSTASFLTQQFE 465
gi 123442754 437 ERYKTQFTQLDKMMTSMNSTVSFLTQQFS 465
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap