Conserved Protein Domain Family
fabG

?
PRK07231: fabG 
3-ketoacyl-(acyl-carrier-protein) reductase; Provisional
Statistics
?
PSSM-Id: 235975
View PSSM: PRK07231
Aligned: 132 rows
Threshold Bit Score: 223.168
Threshold Setting Gi: 37526246
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
68535295    4 YNYAGLTVIVTGGTRGIGHATALQLAASGAN-VVITGRKP---ETVGPAAEELqaaarkqnpdaGRVIGIAAHVADPEAA 79 
16262633    5 NILDGKVVIVTGASSGIGRAIAIRAAEHGAKaVIVSDVVEaprEGGEPTASEIrk-------lgAESVFVKADVSRKVDN 77 
55379587    3 TLLEDKVAVVTGGASGFGRAICRRYAEHGAD-VIVADRQQdprEGGKPTHELVeae------tdRTAHFVECDVTDPDDL 75 
292655188   2 SLLDGRVAVVTGGSSGIGRGIALAYAEAGAD-VVVCDIREeakEGGAPTHEQIesd------tdSSATYVELDVTDPAAF 74 
289580983   3 PLLTDDVAVVTGGSSGNGRAIARQFASEGAD-IVVADIQEsprEDGKPTHELIeae------tdAKATFVECDVTNVDDL 75 
289581445   3 QVLENEVAVITGGASGIGREIARRFAADGAD-IVIADIQDtprEGGEPTHELIdee------teAETAYVECDVSSVDDL 75 
29828912   28 ASLEGKTALVTGGRTGLGFGIATALVERGAN-VVITSRTE---DELRKAAAAlg---------eERALGVAGDARDPEHQ 94 
37526246    3 RMLEGKVVIVTGGASGIGAGIALAAARHGAAtVIIGDITDqprEGGTPVFQRLra-------lgTQAIFHRCDVTSRSEM 75 
150377337   5 NILDGKVVIVTGASSGIGRAIAIRAADHGAKaVIVSDVIEaprEGGEPTASEIrk-------lgTQSVFVKADVSRRADN 77 
284167441   3 DLLAEQTAIVTGASSGIGRSIARTFAEHGAD-VVVADVREeprEGGTPTHELItde------teATATYVDCDVSSVDDL 75 
68535295   80 KKACTQAVEEFGRLDVLINNA-GTNPAFGPVHKQSAEIMTKVFQINTIGPVIWTSAAIEADLG-KAArnggpaGAVVNVS 157
16262633   78 DALVAAA-EEFGGVDVMVANA-GITLKTD-GAEVPEDDYRRLMSVNLDGPLFGAQAAARQMKAlNKQ------GSIVLMA 148
55379587   76 EVAVAAA-EELGGIDIMVNNA-GISEIAD-FYETTEEDYDRLMDVNTKGVFFGAQVATEAMRE-NGG------GTVINMS 145
292655188  75 EAAMDAA-EAFGGGDVVVNNA-GIWRPEE-FLEVTEAEFQQMMDINLKGVYFGAQAAAKRMVE-SGG------GSIINVS 144
289580983  76 ESAVEAA-EEFGGVTVMVNNA-GIFHGEE-FLDVDEDEFGRMMDINVKGVFFGAQAAAKRMVE-ADG------GKIINLS 145
289581445  76 ESAVVAA-DEFGGVTVMVNNA-GIFHGEE-FLQTEEEAFDRMMNINVKGVYFGAQAAARRMVE-ADG------GSIINLS 145
29828912   95 RIAVETAVDRFGSLDLLVNNVgGTERTARRLVDVDLASYRRTVEINLMSALTWVQTAWHGWLG-EHG------GAIVNIS 167
37526246   76 DALVDIA-TPFGGVDLMACNA-GIALATD-GPQINADDFHKLLTVNLDGVLFGAQAAAEQMIKlGKR------GSIVATS 146
150377337  78 NALVAAA-EDFGGVHVMVANA-GITLKTDGA-EVPEDDYRRLMSVNLDGPLFGAQAAARQMKAlNKR------GSIVLMA 148
284167441  76 EATLDEA-EQFGGVDVLVNNA-GIFHAEE-FLEVAADQYEQLMSVNVRGAFFGTQLAAQRMIE-NGG------GRVINVS 145
68535295  158 SIGALSMEDYIGVYNASKAALLHLTKQMARELAP-RIRVNSISPGVVRTKLSEALWK----ENEDSTSTLIPAGRIGEPE 232
16262633  149 SMGGISGAGITVAYSTSKGGVVLMAKSLADALGPdGIRVNAVAPGTIDTELLRTSPGi--aQASEGFRQRTPLRRLGKPA 226
55379587  146 SSGGIRGTGLLVNYCTSKGAVRLFTYALADRLSNyNIRVNAIHPGYSKTQMFEDERid--dTTKMMLKELIPSGRFGEPE 223
292655188 145 SVNGIFGNGNYPSYSASKGAVRTLSYSLAHGLGGdGVRVNAIHPGAIRTKIGPEGAEetgeEQTAQLTAMIPLGRQGEPD 224
289580983 146 SVAGLEGSGEFVTYCGTKGAVRLFTYAMAANLGPdGVRVNAIHPGLIETAMTTDDYPimgtDAEADFLQAIPSRRAGQPE 225
289581445 146 SVAGLEGSGEFVTYCGTKGAVRLLTYSMAAALGPdGVRVNAIHPGLIETTMTTDDVSiigsEDEDAFLESIPSRRAGQPD 225
29828912  168 SIAGELAVPDGTAYGTAKAALNHFTRQMANELAP-AVRVNGVASGTVLTDFTRANVE----GREDKVIGSIPLRRLGEPA 242
37526246  147 SMGSIRTGQLTTAYSTSKAGVNMMVAALADAFGPsGIRVNAVCPGLINTALPLSSPEv--aKMFDGLRERMPLRRLGEPE 224
150377337 149 SMGGISGAGITVAYSTSKGGVVLMAKSLADALGPdGIRVNAVAPGTIDTELLRTSPGi--aQASEGFRQRTPLRRLGKPS 226
284167441 146 SIAGLVGNGSYVAYCVSKGAVRLLTYATAHRLGPdGIRVNAIHPGGIETAMMEDAHmg--pEALKQFTQAIPSRRIGDPE 223
68535295  233 DIADAIAFLAAPTSSWLTGENLVVDGGMLV 262
16262633  227 EVGDAVAFLGSDLSSYVSGTALLVDGGLLA 256
55379587  224 EIADVATFLASDMASYVNGESVVVDGGLTN 253
292655188 225 DVAGVAVFLASDLSKYVTGESIVVDGGWTS 254
289580983 226 DVADAALYLASDLSDYVTGESLVVDGGMTN 255
289581445 226 EIADAAVYLASDQSSYVNGESLVVDGGMTN 255
29828912  243 DVGAAVAFLLSDEASWITGHTLVVDGGRLL 272
37526246  225 EVGNAVVWLGSDLASFITGVSLLVDGGQTV 254
150377337 227 EVGDAVAFLGSDLSSYVSGTALLVDGGLLS 256
284167441 224 DIAGAALFLASDLSSYVNGESLVVDGGYTH 253
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap