Conserved Protein Domain Family
PRK03996

?
PRK03996: PRK03996 
archaeal proteasome endopeptidase complex subunit alpha
Statistics
?
PSSM-Id: 235192
View PSSM: PRK03996
Aligned: 94 rows
Threshold Bit Score: 323.709
Threshold Setting Gi: 161528822
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
302348939   3 MAAPPS-AYDRAITIFSPDGELYQVRYAFEAVRKGWTSLGVLTDSGVILAAEKRKITPLLDLNGIEKIYKVDDHIGVTFA 81 
119719497   3 PAAPMA-GYDRAITIFSPEGRLYQVEYAFEAVKRGMTALGVKAVDGVVLAVEKRSASPLVE--GTEKIKKIDSHVGVAFA 79 
16082284    1 -MQQGQmAYDRAITVFSPDGRLFQVEYAREAVKKGSTALGMKFANGVLLISDKKVRSRLIEQNSIEKIQLIDDYVAAVTS 79 
13541135    1 -MQQGQmAYDRAITVFSPDGRLFQVEYAREAVKKGSTALGLKFSNGVLLISDKKIRSKLIEQNSLEKIQLIDDYVAAVTS 79 
48477876    1 -MQQGQmAYDRAITVFSPDGRLFQVEYAREAVKKGSTALGIKFKDGVALISEKKVRSRLVEKTSLEKIQLIDDRVAAVTS 79 
124027453   4 PAPPAMmGYDRSTAMFSPDGRLFQVEYAMEAAKRGWTMVGVRARDGVVIVAEKKKTSPLIDIEQLEKVYMVDEHIGAGFV 83 
159042303   1 MFSPQMaGYDRAITIFSPEGELYQVRYAGEAVKRGWATVGLKCSDGVVLAAEKRKLGPLIDLNSIEKVYMIDTHIGAASA 80 
41615303    4 MQLPQVmGYDRASTLFSPDGRLLQVEYARTTVKQSPTAIGMLYKTGVLVIGDKKIVEKFVIPSSIEKVYIVDDHVIAAPA 83 
161528822   1 --MMASkGYDMTPTMYSPDGRIYQVEYAIETVKRGTLAIGVASKQGVIMAVEEKPRT-LQSTDVTQKIFQVDYHIGVAAA 77 
170290986   1 -MFPQVtGYDRAITVFSPDGRLLQVEYALSATKRTPLAIGMKCKDGVVLLAVRKYLSPLATPP--EKIYRIDEHIGAIAA 77 
302348939  82 GMGSDGRVLIDYARLVAVRHRLTYGEAPSTEYVVKSVADLKQLYTQHGGVRPFGVALVFGGVDSDGtPRLFRTEPGGQYF 161
119719497  80 GLFGDARVLIDQARIYAQSHRLVYGEPIPIELLVKRICDIKQVYTQHGGVRPFGVAFLFAGVDRKG-PHLIQTDPGGTYL 158
16082284   80 GLVADARVLVDFARISAQQEKVTYGSLVNIENLVKRVADQMQQYTQYGGVRPYGVSLIFAGIDQIG-PRLFDCDPAGTIN 158
13541135   80 GLVADARVLIDFARISAQQEKVTYGSLVNIENLVKRVADQMQQYTQYGGVRPYGVSLIFAGIDQIG-PRLFDCDPAGTIN 158
48477876   80 GLVADARVLIDFARISDQQEKVTYGSLMNIENLVKRVADQMQQYTQYGGVRPYGVSIIFAGLDSIG-PRLFDCDPAGTIN 158
124027453  84 GFGSDGRVLIDYARQLAIQYKFIYGEKIPVEYLTRQICDLMQLYTQHGGVRPFGVTLLIVGVDDSG-PKLFVAEPSGQYM 162
159042303  81 GLLSDARILIDYAREQAQVYRLLYDEQADVEYITKRISDLEQAYTQHGGVRPFGIALIIGGVDKNG-PRLYQTDPSGIYF 159
41615303   84 GIIGDGRVLIERARVIAQTYKYFYGHPIDIRGLVKEIADIKQEYTQIGGVRPFGVSIIFAGIDDTG-KHIFVTEPGGMFW 162
161528822  78 GYIPDARVQVDSARFFSQGNRMTYDESVEVATVAKHLADQAHQFTQYGGVRPNGVSMIIAGVDQKG-ESIYVTDPSGTYV 156
170290986  78 GLVGDGLVLIERGRMEAQYNRLIYGEPITVKNLAKRLALYKQQFTQYAGLRPFGVMIIIGGIDEG--PELYVTHPGGAYY 155
302348939 162 SYYAIAIGLGGDAANSYLEKNYKKDLSLDDAIKLAIIALFkgrvASSDEkKEDlanafDEYVEVAYIDTKERTFNKVGRD 241
119719497 159 RCKARAIGAGAQKALDLFVKEYHDDIKIEEATLLALRGLK----EAMED-GFT-----PENIELARIDVYTKEFKIFSTE 228
16082284  159 EYKATAIGSGKDAVVSFLEREYKENLPEKEAVTLGIKALK----SSLEE-GEE-----LKAPEIASITVGNK-YRIYDQE 227
13541135  159 EYKATAIGSGKDAVVSFLEKEYKEGLSEKEAVTLGIKALK----ASLEE-GEE-----LKAPEIASITVGSK-YRIYGAE 227
48477876  159 EYKCVSIGAGKDQVTAYLEKEYKENLSEDEAIRMGIAALK----SAVAD-ESS-----MKEPEIASIKMGET-FHVFTSE 227
124027453 163 SYKAHGLGQGGGQAIEILQREYRDDIDVEGAILLGIRAVA----SVMEG-KPT-----PETLEVGVADTRTGRFRKLTKE 232
159042303 160 GYYATALGSGSTLILEYLEKNYKYEMDINSCIKLTIKSLS----LVAE--SLD-----ADRFEIGVIDAKTKSFRKLTID 228
41615303  163 EYKLAVIGEGEQKVLDYLGKEYNENLSLKKAIELGLKALYnf-yKENNN-ELT-----AEKLDIAYVDEKTKKAKYVDVN 235
161528822 157 QFAAIAIGAGSDDVNAFLEKNYKEDMSLEDAAALAIAAIN----LKAEE-KGG-----VKDIKMAKVSTESKIFEKVSEA 226
170290986 156 DYAAFAVGKNSDKVNETFRQSFKQEFSLDECIKYAVKVAM----ESEEE-EVN-----ENYLEIATIDVNTRKFRELQKD 225
302348939 242 VIKEIVKSsrgemLSS 257
119719497 229 ELAKLFEK-----LR- 238
16082284  228 EVKKFL---------- 233
13541135  228 EVKKFL---------- 233
48477876  228 EVSKYLN--------- 234
124027453 233 ELLKYIEK-----LGA 243
159042303 229 ELSKLIEEaknegLPQ 244
41615303  236 EIEKILEK-----IKS 246
161528822 227 DLQNYSQN-----ASK 237
170290986 226 EIAKYVNL-----ARG 236
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap