Conserved Protein Domain Family
rplV

?
PRK00565: rplV 
50S ribosomal protein L22; Reviewed
Statistics
?
PSSM-Id: 234793
View PSSM: PRK00565
Aligned: 928 rows
Threshold Bit Score: 106.333
Threshold Setting Gi: 241190438
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

PRK00565 is a member of the superfamily cl00327.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 239918194   1 MEAKAIARHLRVTPMKARRVVDLVRGKQATEALAILKFAQQGASEPVYKLVTSAVANArvkadREG---QAFDEDALYIT 77
gi 189501206   1 MQAKAVLRHTPTSPRKMRIVAGLIRGKQVDQAKAILMNSTKAASRNVMQTLKSAVANY-----SQKnpdTRAGDNDLFIK 75
gi 194334856   1 MQAKAILRHTPTSPRKMRIVAGLIRGKQVDQAKAILLNSTKAASRQVIQTLKSAVANY-----AQLnpeDRAGDNELVVK 75
gi 78189802    1 MEAKAVLRNTPTSPRKMRLVAGLVRGKQVNQAKAILLNSTKAASKNVMLTLKSAVSNY-----TLNnpdERVSDQELFVK 75
gi 21674993    1 MQAKAILRHTPTSPRKMRLVAGLVRGKRVDQAKAILHNSTKSASRNVMVTLKSAVANW-----SQLnpdERLNDNELFVK 75
gi 188996234   3 NTARAILRYAHLSPYKARQVINLIRGKDIATALAILSQIPKKSARIVEKVLKSAIANA-----EFK----GMDIDNLYIS 73
gi 193214805   1 MEARAILRHTPTSPRKMRLVADLVRGKQVDAAKAMLAHSTKHAARTVLQTLSSAVANY-----SQAnpeKRLDESELIVK 75
gi 225849543   3 NTARAILRYAHLSPYKARQVINLIRGKDVATALAILQEIPKKSARVVEKLLKSAISNA-----ELK----GMDIDNLYIA 73
gi 225850740   7 KEARAVLRYARTSPTKARQVINLIRGKDVGVALALLQGLNKRAARMVEKLLKSAISNA-----EQK----DMDIDNLYIK 77
gi 225873073   6 REFRAEARFQRVSPQKARLVLELIKGRGVEEALHTVAFTKKSVAPLVEKVLRSAIQNAnylsqEQG---LDVDVDNLYVK 82
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|
gi 239918194  78 EAFVDEGPTMKRFQPRAQGRAYRINKRTSHVTVVVASKdE 117
gi 189501206  76 EIFVDEGPTIKRMLPAPMGRAYRIRKRSNHLTIIVDTV-N 114
gi 194334856  76 TIFVDEGPTIKRMLPAPMGRAYRIRKRSNHLTIVVDKGnP 115
gi 78189802   76 AIFVDGGMTLKRTLPAPMGRAYRIRKRSNHLTIVVDKVkN 115
gi 21674993   76 AIFVDEGPSLKRLLPAPMGRAYRIRKRSNHLTIVVDKVeN 115
gi 188996234  74 KIHAEEGPMLKRYTPKAHGRATMIRRRFSHIYVYLAEKqQ 113
gi 193214805  76 RIYVDQGVTLKRILPAPMGRAYRVRKRANHLTIIVDEAnP 115
gi 225849543  74 KIHAEEGPMLKRYTPKAHGRATMIRRRFSHIYIYLAEKqE 113
gi 225850740  78 EIRAEDGPILKRYIPRAYGRATMIKRRFSHIYITLAERe- 116
gi 225873073  83 QAVANDGPRMKRIRPAPMGRAYRYQRRLAHIVISVAERaQ 122
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap