Conserved Protein Domain Family
COG5048

?
COG5048: COG5048 
FOG: Zn-finger [General function prediction only]
Statistics
?
PSSM-Id: 227381
View PSSM: COG5048
Aligned: 49 rows
Threshold Bit Score: 36.5974
Threshold Setting Gi: 1723676
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1177049   450 ATPGVYLLSSGPSLTDLLTMNSAHAGAGGYMSSHHSPFDLGCFSHDKPTVSEFNLPSSFPNTIPSNSTTASNSYSNLANQ 529  baker's yeast
19173600    1 ---------------------------------------------------------------------------MLKNR 5    Encephalitozoon c...
1723598     1 MSLYPLQRFESNDTVFSYTLNSKTELFNESRNNDKQHFTLQLIPNANANAKEIDNNNVEIINDLTGNTIVDNCVTTATSS 80   baker's yeast
1352985   291 DTPCTASTSATSGHKFVQDHQSSNNDDVFHKYCKFCEESTDNQPCSKHMHLESKPPQLPPKCSSLRKPTNTLQGTNHAYH 370  baker's yeast
462626     57 PEYTFGQFSMDSPHRTDATNTPILTATTNTTANNSLMNLKDTASLATNWKWKNSNNAQFVNDGEKQSSNANGKKNGGDKI 136  baker's yeast
462625    127 TTLTSPYPMNDILYNMNNPLQSPSPSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRLSLPNGA 206  baker's yeast
1708268    61 TTVSSNKDDVMVNSGARELPMPLHQQQYIYPYYQYTSNNSNNNNVTAGNNMSASPIVHNNSNNSNNSNISASDYTVANNS 140  baker's yeast
1710120       -------------------------------------------------------------------------------- baker's yeast
6325270     1 ------------------------------------------------MNFSLSKQSSEKQSSYTDKSRSPNIGMCTVNY 32   baker's yeast
6325272       -------------------------------------------------------------------------------- baker's yeast
1177049   530 TYRQMSNEQPLMSLSPKNPPTTVSDSSSTINFNPGTNNLLEPSMEPNDKDSNIDPAAIDDKWLSEFINNSDPKSTFKINf 609  baker's yeast
19173600    6 VEVDRRRLDFSEESSAGEYNGKYLGFHEQAGETGTYRKVIYSQEGKLVPPQYHTWDRNPHHKDTSPSDKKYHSEYR---- 81   Encephalitozoon c...
1723598    81 NQLERRLSISDYRTENGNYYEYEFFGRRELNEPLFNNDIVENDDDIDLNNESDVLMVSDDELEVNERFSFLKQQPLDGL- 159  baker's yeast
1352985   371 EHILNTDMDLKILEDLCNISSLYEVPFGKHINHHDHNNAGNGCDGSSTGNNENGNQTMNLLLSSINRCNPKNNLNGSNN- 449  baker's yeast
462626    137 YSSVATPQALNDELKNLEQLEKVFSPMNPINDSHFNENIELSPHQHATSPKTNLLEAEPSIYSNLFLDARLPNNANSTTg 216  baker's yeast
462625    207 NSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLNSSYFNSLNIDSMLDDYVSSDLLLNDDDDDTNLSRRr 286  baker's yeast
1708268   141 TSNNNNNNNNNNNNNNNIHPNQFTAAANMNSNAAAAAYYSFPTANMPIPQQDQQYMFNPASYISHYYSAVNSNNNGNNA- 219  baker's yeast
1710120     1 -----------------------------------------------MRGKQPKRNKDNASVKRNYRCVGYPDCN----- 28   baker's yeast
6325270    33 KSNLPLQVSAVDQLSTGKGTQFYGHNSYKNERECYNSTKINLPPISSLLPNFENNTPPNVDSRVQFPPQQVYQSMN---- 108  baker's yeast
6325272     1 ----------------------------MWRTKTLESMLCSPMKCSSSNIGGSYAQSSKEVSNTTKREVHLPPCSS---- 48   baker's yeast
1177049   610 nhfndigfiysppssRSSIPNKSPPNHSATSLNHEKASLSpRLNLSLNGSTDLPSTPQNQLKEPSYSDPISHSSHKRRRD 689  baker's yeast
19173600   82 -----------------EGESDSRLDTP----------------ISIEAKWSHYSSEYFEASDSEEFDEKLASLRLLILE 128  Encephalitozoon c...
1723598   160 ---------------NRISSTNNLKNLEIHEFIIDPTENI-DDELEDSFTTVPQSKKKVRDYFKLNIFGSSSSSNNNSNS 223  baker's yeast
1352985   450 ---------------NTAGATSTDHQHHHHRIQFHSHKPNrNNIVNNSGISAANTTADLTNNDLNDLISREYSYERFRNQ 514  baker's yeast
462626    217 lndnd----ynlddtNNDNTNSMQSILEDFVSSEEALKFMpDAGRDARRYSEVVTSSFPSMTDSRNSISHSIEFWNLNHK 292  baker's yeast
462625    287 fsdvi----tnqfpsMTNSRNSISHSLDLWNHPKINPSNRnTNLNITTNSTSSSNASPNTTTMNANADSNIAGNPKNNDA 362  baker's yeast
1708268   220 ---------------ANNGSNNSSHSAPAPAPGPPHHHHH-HSNTHNNLNNGGAVNTNNAPQHHPTIITDQFQFQLQQNP 283  baker's yeast
1710120    29 -----------------MSFNRTEHLAR-----------------HIRKHTGEKPFQCNICLKFFSRIDNLRQHQSSVHS 74   baker's yeast
6325270   109 ---------------VVPIVNEIYTPISMN-------------ATSDQYPIYYTESQQPIPHSQSPHLTSSAPLMMPVMV 160  baker's yeast
6325272    49 ----------------IMHAPLT-PEIN-----------------QAALPPPAYHYAPSSLHQTEDPVWRSSPNSIIFSP 94   baker's yeast
1177049   690 SVMMDYDLSNFFSSRQLDISKVLNGTEQNNSHVNDDVLTLSFPGETDSNATQKQLPVLTPSDLLspfsvpsvsqvlftne 769  baker's yeast
19173600  129 AEEEMRRIVQGRVDKHLEMNKEANEKKKEMKRRKREVLGEVNKVRGEAGDRDDRSCERPEE------------------- 189  Encephalitozoon c...
1723598   224 LGCEPIQTENSSSQKMFKNRFFRSRKSTLIKSLPLEQENEVLINSGFDVSSNEESDESDHAII----------------- 286  baker's yeast
1352985   515 SEPPSLPKVTHQNQKNRRSWPTKDLESTDFSSLEDSLPSSISPPIQTTSTINFNWCFKEEKNND---------------- 578  baker's yeast
462626    293 NSSNSKPTQQIIPEGTATTERRGSTISPTTTINNSNPNFKLLDHDVSQALSGYSMDFSKDSGIT---------------- 356  baker's yeast
462625    363 TIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSFDANAMTKINPSQQLQQQLNRVQHKQLT---------------- 426  baker's yeast
1708268   284 SPNLNLN-INPAQPLHLPPGWKINTMPQPRPTTAPNHPPAPVPSSNPVASNLVPAPSSDHK------------------- 343  baker's yeast
1710120    75 --DVD---------LMSLRRLQQSANSTANDPNATRMFPQLRPYGIVVQPAPVPYNLPIST------------------- 124  baker's yeast
6325270   161 PTVYKPLTPYDKEPITIASEPNFTAISMASHPNAALELCHDRPKSVPPGYGVLPTMQEASNGR----------------- 223  baker's yeast
6325272    95 VIATPQPFPLTFVERQSCCPIYSTAASSYTAQSVPPSMQHFQEENHRAVSNEQYSLPNVHIG------------------ 156  baker's yeast
1177049   770 LRSMMLADNNIDSGAFPTTSQLNDyvtyYKEEFHPffsfiHLPSIIPNMdsyPLLLSISMVGALYGFHSTHAKVLANAAS 849  baker's yeast
19173600  190 ESDAKGTRIESFADFETSMFPYK------SKNGA-------KSYACPYEg---CTMELPTLSRIKRHYIVHTKLRPFKCL 253  Encephalitozoon c...
1723598   287 NPLKLVGNNKDISTQSIAKTTNP------FKSGSD------FKMIEPVS---KFSNDSRKDLLAAISEPSSSPSPSAPSP 351  baker's yeast
1352985   579 LKCKWKECPESCSSLFDLQRHLLK-----DHVSQDfk-hpMEPLACNWE---DCDFLGDDTCSIVNHINCQHGINFDIQF 649  baker's yeast
462626    357 KPKSISSSLNRISHSSSTTRQQRAsl-pLIHDIESfa--nDSVMANPLS---DSASFLSEENEDDAFGALNYNSLDATTM 430  baker's yeast
462625    427 SSHNNSSTNMKSFNSDLYSRRQRAsl-pIIDDSLSyd-lvNKQDEDPKNdmlPNSNLSSSQQFIKPSMILSDNASVIAKV 504  baker's yeast
1708268   344 YIHQCQFCEKSFKRKSWLKRHLL------SHSQQ-------RHFLCP-----WCLSRQKRKD----NLLQHMKLKHTNYL 401  baker's yeast
1710120   125 --PASPQDTISLYAPPYFPHPMP------SAPIP-------LPHQPP---------PLPIYSYMQPLFLNHTPIQNHNIV 180  baker's yeast
6325270   224 TKSEPGAVLNGSATFSDWKTDTR------ISSTK-------LRKQCP-----VCGKICSRPSTLKTHYLIHTGDTPFKCT 285  baker's yeast
6325272   157 -QNPGTLLSQTQTDLDLIQKQLR-------AVVK-------LRKQCP-----ICGKVCSRPSTLRTHYLIHTGDTPFKCT 216  baker's yeast
1177049   850 TQIRKSLKVSEKNPEttelwviqtlvlltfycifnkntavikgmHGQLTTIIRLLKASRLNLPLESLCQPPIESDHIMEY 929  baker's yeast
19173600  254 NKDCNKRFSRKDN----------------------------------MLQHYKIHCNYSNYR------------------ 281  Encephalitozoon c...
1723598   352 SVQSSSSSHGLVVRK-----------------------------KTGSMQKTRGRKPSLIPDASKQFGCEFCDRRFKRQE 402  baker's yeast
1352985   650 ANPDSFLPGSISKEK-----------------------------HHLLHCPNPQTHEVSKADGAPDMTSANDVSNIPPIK 700  baker's yeast
462626    431 SAFDNNVDPFNILKS-----------------------------SPAQDQQFIKPSMMLSDNASAAAKLATSGVDNITPT 481  baker's yeast
462625    505 ATTGLSNDMPFLTEE-----------------------------GEQNANSTPNFDLSITQMNMAPLSPASSSSTSLATN 555  baker's yeast
1708268   402 LDELKKNNIIFNYNN-----------------------------SSSSNNNNDNNNNNNSNSASGSGGAGAAAAAATAPE 452  baker's yeast
1710120   181 ELPPDSSDTPASPSK------------------------------VQSFDQAKDASPNAKK------------------- 211  baker's yeast
6325270   286 WEGCTKSFNVKSNML-----------------------------RHLKSHERKRNKVLNTT------------------- 317  baker's yeast
6325272   217 WEHCNKSFNVKSNML-----------------------------RHLRTHQKKIAKKKHQ-------------------- 247  baker's yeast
1177049   930 ENSPHMFSKIREQYNAPNQMNKNYQYFVLAQSRIRTCHAVLLISNLFSSLVGADCCFHSVD 990  baker's yeast
19173600      ------------------------------------------------------------- Encephalitozoon cuniculi
1723598   403 HLKRHVRSLHMCEKPFTCHICNKNFSRSDNLNQHVKTHASL-------------------- 443  baker's yeast
1352985   701 QPEQVICQWDGCNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKV 761  baker's yeast
462626    482 PAFQRRSYDISMNSSFKILPTSQAHHAAQHHQQQPTKQATVSPNTRRRKSSSVTLSPTISH 542  baker's yeast
462625    556 HFYHHFPQQGHHTMNSKIGSSLRRRKSAVPLMGTVPLTNQQNNISSSSVNSTGNGAGVTKE 616  baker's yeast
1708268   453 NEDGNGYDT--NIKTLINDGVLNKDDVKRVLNNLIVSHNK--------------------- 490  baker's yeast
1710120       ------------------------------------------------------------- baker's yeast
6325270       ------------------------------------------------------------- baker's yeast
6325272       ------------------------------------------------------------- baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap