Conserved Protein Domain Family
MRS6

?
COG5043: MRS6 
Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion]
Links
?
Statistics
?
PSSM-Id: 227376
View PSSM: COG5043
Aligned: 5 rows
Threshold Bit Score: 817.584
Threshold Setting Gi: 19113372
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
COG5043 is a member of the superfamily cl25572.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125     1 MLESLAANLLNRLLGSYVENFDPNQLNVGIWSGDVKLKNLKLRKDCLDSLNLPIDVKSGILGDLVLTVPWSSLKNKPVKI 80
gi 19074146    1 MLKRILLKTLNRFLGNYVENIDKHQLELGIFKGYVSVSNLRIKSSVISRL-FDGRVVSNRIGTLRVLVPWKSLARKPVEI 79
gi 19113592    1 MLEGLLANFLNRLLGEYIENFDATQLKVAVWNGDVTLRNLQLKRSAFRKLELPISVQYGLVEELTLKIPWSSLKNKPVEI 80
gi 19113373    1 MLEGLVAGLLNKILGSYVDNLDTKQLNIGVWGGHVSLHNLRIKPEALDKLGIPIEITSGLIGTFTLEIPWSNLRNKSLTI 80
gi 19113372      --------------------------------------------------------------------------------
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125    81 IIEDCYLLCSPRSEDHENDEEMIKRAFRLKMRKVSEWELTNqarilstQSENKTSSSSSEKNNAGFMQSLTTKIIDNLQV 160
gi 19074146   80 YIRDVDIKIGKAGFCWCFLGESP----CMECIEYEKYEFMS-------KLDKLSFLSDAREGGSAFFEDLIMG--DGFRV 146
gi 19113592   81 YIVGIRALASMEENVKSQSEVDPHQVLESKRRQMQLWEAS----------QIGKAETAYDPKTQTFTESLITRMIDNIQI 150
gi 19113373   81 NIEDIYLSIHPQAKNSLTRDELEQSQQALKQEQLDSFEILRkn---frETLEESSSNPNISRKQSFIEYLIAKLTDNIQI 157
gi 19113372      --------------------------------------------------------------------------------
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125   161 TIKNIHLRYEDMDG-IFTTGPSSVGLTLNELS-AVSTDSNWAPSFIDIT---QNITHKLLTLNSLCLYWn--TDSPPLIS 233
gi 19074146  147 LVEDVNVEYVSGTSiALRVQRLEFNGKGGSVRnAKNLDITGVEMAVASK-----VMGPLNICSIVKMSP---RDMKPRIE 218
gi 19113592  151 NIRDIHIRFEHLPVsNVVPGGYSFGLLLSEFS-IESCNEEWTSTFVETE---SQTIYKLCSLRGFGIYS---DETAECID 223
gi 19113373  158 YIERIHLRFEDNLS--DLEKPYSLGLTLYSLR-VTSTDASFTEYLLSTDpipSSCIHKIITVDYFSIYWiskCEISKCTT 234
gi 19113372      --------------------------------------------------------------------------------
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125   234 DDDQDRSLENFVRGFKDMIASKNstapkhQYILKPVSGLGKLSINKLGsTEEQPHIDLQMFYDEFGLELDDTEYNDILHV 313
gi 19074146  219 VHLDDFRLEMRQQMIEEILVGFK------EYSEDRVRWTLFRSHPEYRkVLEMAREMNLWEDQKDPASVERADVVEVWKH 292
gi 19113592  224 KTDINELMNTFQALITDFQSREK------DYIIAPVTGMAKVTINKLP-TPEIPRFLSQISFRGFDVSLNDSQISCGMSL 296
gi 19113373  235 TEDIFSYLKNLIP-SAEKSPAYN-------YILKPLRATAHVVLFRHP-TDQIMQLRGKLSVEEISITLSDHMYYSLLGV 305
gi 19113372      --------------------------------------------------------------------------------
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125   314 LSSIQLRQITKKFKKARPSFAVSENPTEWFKYIAACVINEIHEKNKMWTWESMKEKCEQRRLYTKLWVEKLKLKNLEApl 393
gi 19074146  293 LIQLQKKIGDSKGVALEEIAGIMSRASEYRKVLGRPSLRPDEVEKKKRCER---EICLER--LLKIKRSCVFDSEKKS-- 365
gi 19113592  297 AHELQDVMSKLAFRKRIVGNVSLDTPLDYLRFIFQKTLHDIQQKHYARSWPAIKAFCEKRRNYIKLYKKKFLAVQLSA-- 374
gi 19113373  306 IDYFRVVMKQQYYLQYRPKSTPKEKPLEWFKYAILVVKDSVHESRYHWTWKYFKRRRDDRIAYMHIIRKRYLNEQISKee 385
gi 19113372      --------------------------------------------------------------------------------
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125   394 rDPIQEAQLSELHKDLTYDEIILFRSVAKRQYAQYKLgmtedsptptassniePQTsnksatKNNGSWLSSWWNGKPTEE 473
gi 19074146  366 -WKSFLLFMKERASKKKTSTVVPMVFNVKRAALTVID-------------------------EKHQGFRIVLPEGRVSAR 419
gi 19113592  375 -DESKELDVLELNLDIS--QLKLFRSLAYQEIKNEGFe---------------PQP------PKQQGWGSWMWNSFRGAS 430
gi 19113373  386 iDLQKKIEKRNSTYDLIKYRSRVHTSLIEERNSIYLK----------------PKTsa---aHGLYDWFSG-YIRKPQSQ 445
gi 19113372      --------------------------------------------------------------------------------
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125   474 VDEDLIMTEEQRQELYDAIEFDENEDKGPVLQVPRERVELR-------VTSLLKKGSFTIRKKK--QNLNLGSIIFENck 544
gi 19074146  420 DLLSPARLDFKGNEWKMYFVDTRLNEHEPYNELISFLLDVR--------------GTFAYDGPGihVKGLAGEWRVLN-- 483
gi 19113592  431 DENGEVTDDQRKTVIDAIGLNDSIIESAHVGDLQSNTSLFD-------VRLEVPSGKFSLLKYP--KKENVISLELLN-- 499
gi 19113373  446 DEDTLASTDKTAADLTDQEQKEFFSAIEWSGQLYPDTVNLDpdmcmanVEVSIAKGSFVIQSHIngRVIPLIKQRFESfa 525
gi 19113372      --------------------------------------------------------------------------------
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125   545 vdfaqrpdsFLSSFQLNKFSLEDGSPNALYKHIISVRNSSKDQssiDNHATGEEEEEDEPLLRASFELNPLDGLADSNLN 624
gi 19074146  484 ---------YRRELPRCFEGLMRIAGKSWVPSYGSLACRGKVR---ADFKADMVSMESDLERFADIRPSGRYGVESSGVV 551
gi 19113592  500 ---------FFSQFKCNKKDYSFVANLGSLKMYNDDRNFLYPR----ETSNKEIETTSPSIFTLSFERSSSDDNDTDTLG 566
gi 19113373  526 tecfirpqsLKLKVSLKDLDMFDGITNPELEPARVIFAKPSVE---ESESLQKIPEAYRTHLFFLLLDTKPVYKASSTLI 602
gi 19113372      --------------------------------------------------------------------------------
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125   625 IKLLGMTVFYHVHFITEVHKFFKASNQHMETIGNIVNAAEATVEGWTTQTRMGIESLLEDHKTVNVSLDLQAPLIILPLD 704
gi 19074146  552 LSYVNDGISMKKAASLTIASSFVYWINPTSEKSEALSNRIETAILLVDGVFYVKTSMVDLYAHGVHPSDFGGGGTVFPAG 631
gi 19113592  567 INLRALEFFYDPNLLLRV-KGFQSSLFANDNGRKLVRLANDAVTDFTSQTVQNLQEYLNEKRKLNVNFQFQTPLLIFPED 645
gi 19113373  603 VHLRTLVIIYNRVCIESLLAFFVPPRTKIEHVSEWGYSAAAKVMTLARQTRASLDYALEMHKTSDMTIDLQAPLIVVREE 682
gi 19113372      --------------------------------------------------------------------------------
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125   705 PHDWDTPCAIIDAGHMSILSDLVPKEKIKEIKELSPeeydkidgneINRLMFDRFQILSQDTQIFVGPDIQstiGKINTA 784
gi 19074146  632 FVVPN-FEVCSDAIRINGPNGRAELRRIKMSGNGGT----------IFDVEIFRGKVLDRNGRVVCRVPKM----KMEAR 696
gi 19113592  646 CNNPESFSLFVDAGFISITSQNVETNDKESNSESET----------LYHLIYDRYRVSLESARLLLGPLNE---LKNESN 712
gi 19113373  683 CTDLKSPTLFLDVGRALVHTQLVDDAIIDKFRKLQSkkinneqlkqLENLMYDKFTISLFNVRCLIGPDYEt--GWRCLP 760
gi 19113372      --------------------------------------------------------------------------------
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125   785 SSTNDFRILDKMKLELTVDLSILPKAYKLPTIRVFGHLPRLSLSINDIQYKTIMNLIANSIPs-MIDDEENNGDYVNYSS 863
gi 19074146  697 IGKALFLDIEYLKVCG-VARRIAKLAREMSWMAQGGGSTQATLKVG--RVEAILKRKGSILS---ISVDEYFQGLARSVK 770
gi 19113592  713 KINEEYYLMNELNTEIFIQAQRVP-TPQYPRIKVEGNMPCLSFILSDAQFRILNNLASTMLKdgKASDDDDNGDWRPESS 791
gi 19113373  761 KG-CDYHILKECSLDINFEISILQKATNLTKFKVSSHMKHAEIMFSDVQYKVFINMMSNILP--TLPVAEIPFTYQQFLD 837
gi 19113372      --------------------------------------------------------------------------------
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125   864 GSEKEMKKQIQLQLKNtlkalENMQPLQIEQKFLELHFDIDQAKIAFFQCIKNDSRNSEKLVDILCQRLNFNFDKRAKEM 943
gi 19074146  771 ATLNKSIVDIKDLEVG-----EEYACRSAMVKVHKEDIRGLDVFTRIFGGAGGDSGIFKVSVGVLLIRPRNGLEIEAR-- 843
gi 19113592  792 ESLDSHESEYKLN---------NTPSEQSVKVSHFFEFNMKLGEVTLILCREDSQTKRNSMVSVNFAKLLLSFNQFEDNS 862
gi 19113373  838 AVKPPPFFDAPDNFQIthtslGSHANENTAAQFMAQQIFAFYFKVDYAICS-LYRRSENYLIPVVRAFTEFYIDLVVRKF 916
gi 19113372      --------------------------------------------------------------------------------
                        970       980       990      1000      1010      1020      1030      1040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125   944 NLDLRVHSLDVEDYIELTDNKEFKNLISSGVEKVTRSQKDLFTLKYKRVQRIVphNDTLIELFDQDIVMHMSELQLVLTP 1023
gi 19074146  844 NIRAFMNGADITVHPLEIGISGADGSHSPLSGKKREVRVCISKFEKSGIETVV--EGSIGGEIDEEMIVGIRDEMMGIPM 921
gi 19113592  863 HLRMSINSFHINDMLSKSSRDNNRQLMRCYAPDSVDAENTPVIVEIKSVK-----AGENQSETNTTVDFLCANGDFYLAK 937
gi 19113373  917 DYLVTSKLNDLVIKEFTYPSSLCDNVLVRSSPSPKNNFDDTVFISYTSIDYDSpeLDSVYEGVRTTIAVVLSDLILNVEP 996
gi 19113372      --------------------------------------------------------------------------------
                       1050      1060      1070      1080      1090      1100      1110      1120
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  1024 RS---VLTLMNYAMLTFTDPNAPEMPADVLRHNKEDRDDAPQKINMKIKMEAVNVIFNDDSIKLATLVLSAGEFTMVLLP 1100
gi 19074146  922 SSntpTKTNISFDISLYVMASGKSVRMECPLVFRKTVDGWNAVVRRVSVTLGNGEHTVLSGINAKATEDVLGLFIDRIEI 1001
gi 19113592  938 FS---ILTLIEFLPSFAPPPSNDKQSTPQVSNSAAGKMELNFKIHKIGLRLLENYESKPICIDLLALDLSVNSTKGISEV 1014
gi 19113373  997 TG---FSFVYDFIRATFTSLNDEYMIGEDPELTRKISPVEGIIPEDANVRFDNVDIFLYDCDQHFSTVCLYSANMHMEFR 1073
gi 19113372      --------------------------------------------------------------------------------
                       1130      1140      1150      1160      1170      1180      1190      1200
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  1101 ERYNINLKLGGLELTDETNESFSrDSVFRKIIQMKGQELVELSYESFDPATntkDYDSFLKYSTGSMHVNFIESAVNrmv 1180
gi 19074146 1002 CLAPSILALMFYPLLCSEGDARYtKRMKVGIDEILVSIKDLDEMRIRDVKY---DDELSLDLS--------ILSGAG--- 1067
gi 19113592 1015 ESRVDKIQVMAWDHEKDEIVTLI-DSKQDSLFDLKCKMQEGWFIHSPNPST---DVNIKMGSFTMLCHKQPIEEILN--- 1087
gi 19113373 1074 EKFFLQARFYDLEVKNHMKSNNP-PKTIVKIDDNDLFIFKYESYDIPKDISk-pTCDCVYDISFGSLTFYFQKSYFNaiy 1151
gi 19113372      --------------------------------------------------------------------------------
                       1210      1220      1230      1240      1250      1260      1270      1280
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  1181 nFFAKFQKSKVSFDRARLAAYNQAPSIDAVNNM-KMDIVIKAPIIQFPKLVGtQENNYDTMRFYLGEFFIENKFSVIDES 1259
gi 19074146 1068 ---SKVTYRKVSSRKDEYFLLSVAGGCYEMNSLaSVTRFCSSEYVQICEKLG--------IQISKERFHVLLMDLVVQAR 1136
gi 19113592 1088 -YASNFGHYKAIVQSVKYLAETGTHQVQQGTNV-NINLYISNPIFQIPLTL--ENGSSAMVEILPGSFSLKTPSWLPNLT 1163
gi 19113373 1152 dFLLKLKRFQELFSSIRYAIYYKLYGNKVSLTYpKFELRIKHPKVYFDDVLDeERNCRMQLIVKPQSFYAFSKCPIVEKN 1231
gi 19113372      --------------------------------------------------------------------------------
                       1290      1300      1310      1320      1330      1340      1350      1360
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  1260 HKINHIKLGVREGQLSSNLNFDGSSQQLYLVENIGLLFNIDRDPLPQDDTPELKVTSNFESFALDLTENQLTYLLEISNK 1339
gi 19074146 1137 SGLSFLRINLPVGHFDVQELHSLKG-RLLCSLDIYDPSAMKVVPVVEENVFVVKKYGTLLDVR-ALARLRILYLQGITDM 1214
gi 19113592 1164 LNLESKSTTLRTIYYSKDFDEKGNQITVLDDLNISLDGSIVQAVDSAITNYAIDLHCGISELLIHLSQAQYLILLKLASN 1243
gi 19113373 1232 SKKSIFSCEITKVEFHTAVPSSSHHDVLMEENNVHLDLTYDANYTTG--AYVFKATGDLDPVILNMCQSHHVIFWDLIDV 1309
gi 19113372      --------------------------------------------------------------------------------
                       1370      1380      1390      1400      1410      1420      1430      1440
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  1340 VSSAFNITDENSGEsggkgeikSPSPDPASlsSESERTATPQSLQGSNksnIKNPEQKYLDFSFKAPKIALTLYNKTKGV 1419
gi 19074146 1215 VAGFFG-------------------PRKTE-----S--TVPVDPFHCK---VRIKNATDTALQIKT---Q-----GQFGS 1257
gi 19113592 1244 LPEMLSIANAFSAN--------VDAPSVMTllSEELYSIDTVNDAISN---LSQNSSFDMKFGLHFPKISLNLYDGTFIT 1312
gi 19113373 1310 ATTFARVDSSFYTS--------ENLRRELD--KAFDRSGTAAKLKHPK---KTVVETLDILTTFNLPEIRLNVHTDDFWI 1376
gi 19113372      --------------------------------------------------------------------------------
                       1450      1460      1470      1480      1490      1500      1510      1520
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  1420 TSLNDCGLTRIM-FQDIGCSLGLKNDGTVD--GQAHVAAFRIEDVRNIKDNKHTELIPKSKNKeYQFVANISRKNLEVGR 1496
gi 19074146 1258 IGGGEAGEFNIN-YEEHGICVGKGETGTVIniVDSSITSFRAEEKNLIADVLYDGRTRLLTIT-HNLSFFNLCEIDLMGR 1335
gi 19113592 1313 PENSLSPLSNFT-LNEIRAEGSYDLKTGAS--ALIKMASLAIEDVRSEKSRYFSNVIIPSTDTeSQLQVSFQYKPDTSSI 1389
gi 19113373 1377 HGGDLTQLHSILsFFGFSLDYNFYSSGRCY--AEFSIDSIQLKDCNPQDNVVFLDVLEYSEN--HNRLVNGCLEYDSQNP 1452
gi 19113372      --------------------------------------------------------------------------------
                       1530      1540      1550      1560      1570      1580      1590      1600
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  1497 LLNISMTMDspKMILAMDYLVSLKEFFDAIMSKSHENNLYYPEntnQKPENKAIVESVQEGGDVTKIqYSVNIIETALIL 1576
gi 19074146 1336 MHCPNVSAS--EMQIPRHSSHTIPQASTFFLEIGVDGKYSGVG---RIDANAIEKGAVSSFGTVCKL---SGITIGVDVV 1407
gi 19113592 1390 LLEGDIFKS--MYVLSLDHLLSIYYWFGQPLMEKKLESPDDVQs-lQAESSVSTPAVTAASEKSISLsVRFDIRNTSLVF 1466
gi 19113373 1453 RYNLVLDIDspKIFVNLNYLYSIWSIFVHWHRAYYSHLDYLTE---VEYFIMGNPNQNACGEESYWY-YRITFVDMTLLF 1528
gi 19113372      --------------------------------------------------------------------------------
                       1610      1620      1630      1640      1650      1660      1670      1680
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  1577 LADPCDMNSEAISFKIGQFLVTDQNIMTVAANNVGIFLFKMNSSEEK-LRLLDDFSSSLTIDKRNSTPQTLMTniQLSVQ 1655
gi 19074146 1408 VRDAGAMASVAIIFYP-TFEVVNR---TTSVLNLVLSIDKEAVHMNS--KGVLRKNIPFSIGRNCKEDVYDID--SSEIP 1479
gi 19113592 1467 VADASKSTSQAIVLRTDQISLVKQLSYSLTVQKMGMFVTRMDKLDDG-IQILDDFDIGFGLVQDCSENKSFSA--TLDLD 1543
gi 19113373 1529 FRNVSDANLYSLPMFFGELLITQQSIFAVTANNMKINACPLSETANIsNQLADPFGFRYTYSQHTVNKIQIITniTLDFD 1608
gi 19113372      --------------------------------------------------------------------------------
                       1690      1700      1710      1720      1730      1740      1750      1760
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  1656 PLLMRISLRDIRLAMLIFKRVTTLLNKMTEKEDNGEEEESTDKIQFSHEFERKLAVLDPsilgersRASQSSDSEsIEvp 1735
gi 19074146 1480 -LLLVHNLNNQAGTKVFQSRASIQICPGHSGEIRKEQCEIQLFFGRHVLMHKVRMAICP----------PMMIVN----- 1543
gi 19113592 1544 RLLFRISVYDLLLLQSIAQASVSVISSYKDKSSSISENMNSGDYGQQILNASNIAAVQQ-------KAEQTATTLlTVlg 1616
gi 19113373 1609 SFVLRTTVNDFLFLQTILRKIYNFYYALYDVPTTDVELLKRTKDDQLATNPDFLQLSVD-------TGQPSSVFG-IR-- 1678
gi 19113372      --------------------------------------------------------------------------------
                       1770      1780      1790      1800      1810      1820      1830      1840
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  1736 taiLKNETFNADLGGLRFILIGDVHEMPILDMNVNEITASAKDWSTDFEALASLETYVNIFNYSRSSWEPLLEMIPITFH 1815
gi 19074146 1544 ---HLSDDIWIN--GIKFCRGSSCSDR-LKIIHSLCVGEYGADGSVVIRKKSVRVVTLVRKNY-RAHRARVTHEG----- 1611
gi 19113592 1617 hdsLISEEFTINSAGIQLILISDAHCLPVFDFTIENFNVLVKDWSTNLSATTSLTLHCNAFNFAKSHWEPVIEPWTFSTT 1696
gi 19113373 1679 ---ICKEEFLLTVDGIRLLVISQLHDLPLLNINIKPFQVDLNDWSSELNSNAHLELFMNFYNFSNSHWEPFLEPWKVGVH 1755
gi 19113372      --------------------------------------------------------------------------------
                       1850      1860      1870      1880      1890      1900      1910      1920
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  1816 LSKghseMDPAFSFDILTQRIAEITLSARSIAMLSHIPASLTEELPLASRVSQKPYQLVNDTELDFDVWIQDKTTEDNKN 1895
gi 19074146 1612 --------------MVWTNEAIFGGLGPRAGAYPDYIHFLLEFKGDSSTRIVEFRYTHFIRNQTRMRLLAVSEQVCYYVE 1677
gi 19113592 1697 AIM----KDGMHEVNINSDDIAQISLTPMMVTDVHRLIKFYLTNQENNIEKRPEGYPYVILNQTGYNLSIQYGNLNSSEM 1772
gi 19113373 1756 ISRn--pNTSKTAVHVFSREKLDLVITPQLIETLHFGFTKVISTPFPIEFKCDAPYRIHNYTGHAVSVWADFENAADS-- 1831
gi 19113372      --------------------------------------------------------------------------------
                       1930      1940      1950      1960      1970      1980      1990      2000
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  1896 EVVLLKANTSLPWEFEDWRSIREKLDIDKSKNILGVCVSGQNYKTIMNIDATTEGENLH-VLSPPRNNVHNRIVCEARCD 1974
gi 19074146 1678 AGEEVPFNTSTNGFYLFIADCLDIRSLRSCGVFIPLDIKTTKYFRLQ-----GSEAVLL---SVSRSVDSEQHVFGIRME 1749
gi 19113592 1773 QSLSLPSGKCVPCRFESKEVLTSRMSSKVQDVATKVRVSFDSTWYPVDEVSVHQEGSFL-YELKPRIDQRTFLLVTVVLL 1851
gi 19113373 1832 CVRHLENNEETDWKFEEWRQMQDVVKQDQDRSYIGFHFENSKWESLRHVRVNRVGEHIYpLISYDQDELKHYMVVDVNLG 1911
gi 19113372      --------------------------------------------------------------------------------
                       2010      2020      2030      2040      2050      2060      2070      2080
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  1975 ENNVKIITFRSTLVIENTTSTEIELLVDSKDPNKPSLKYAIKPHQSKSVPVEYAYDSDIRIRPASEDIYDWSQQTLSWKS 2054
gi 19074146 1750 SD--------WPYMIYNDTDTNMKFTQGHDTVEHDVKRESVYRYALDSLVFDPVILLRVGDRSIQVDLNRDGSMVTSGIV 1821
gi 19113592 1852 ESNIKQIILSSPYSIVNRTKEVIEVVCNDRSGHRQSSVIKIDPNETGYVPLDLACLYPLRIRPVSKLGFLWSNQIVDWHS 1931
gi 19113373 1912 EDYIKHITLRSPLLLINETQMEIDVVFCDSDGIQRSQIYHMSPEESCSLPIETAYYYSIHIRPVSEFKFNWTSEAISWKD 1991
gi 19113372      --------------------------------------------------------------------------------
                       2090      2100      2110      2120      2130      2140      2150      2160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  2055 LLSNQMSIFCSSKedsnqrfhfeigakydereplakifphmkivvsasmtienllpa-dinfsifdkreekrtdflktge 2133
gi 19074146 1822 VSASQGKIARILR------------------------------------------------------------------- 1834
gi 19113592 1932 LNKSPLQYLTCEStstswkhnllvfarnlmdgslqndypflqlnilptlqienllpyeinlriierssgndwrsslspgd 2011
gi 19113373 1992 LVDNKQSLVTC--------------------------------------------------------------------- 2002
gi 19113372      --------------------------------------------------------------------------------
                       2170      2180      2190      2200      2210      2220      2230      2240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  2134 smevhhisldsfllmsvqplqDeasaskpsivntphksplnpedslsltlsggqnlllkldyknidgtrskv--iriysp 2211
gi 19074146      --------------------------------------------------------------------------------
gi 19113592 2012 slpilhtdsksfllmginvpdLdlqpvdlpiiytpissgqdvqtsalltasdkqdvvklilkyeklpgtnyvskvmiypp 2091
gi 19113373 2003 ---------------------Q---------------------------------------------------------- 2003
gi 19113372      --------------------------------------------------------------------------------
                       2250      2260      2270      2280      2290      2300      2310      2320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  2212 yiimnstdrelyiqssllniaqskillenekrytipkmfsfdkEDdksnrarirfkesewssklsfdaigqsfdasvrik 2291
gi 19074146 1835 -------------------------------------------IS----------------------------------- 1836
gi 19113592 2092 yvifnhtdlsiqvtssspnsirytipsgsysndikpyfysfdeSGrknramisidngtswsadigfdtlgsssqvevrkt 2171
gi 19113373 2004 -------------------------------------------HS----------------------------------- 2005
gi 19113372      --------------------------------------------------------------------------------
                       2330      2340      2350      2360      2370      2380      2390      2400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  2292 nkeqesnlginisegkgkyllskvieiapryiisntldipievcetgsmdvqqiesnitkplyrMrnivdkqlvlkflgg 2371
gi 19074146 1837 ----------------------------------------------------------------R--------------- 1837
gi 19113592 2172 nesdvcllgmsisessgkfcltksvtftprfvfknhldctvslrefgsskvlhlpsnelipmmyFsnpqeialllslpss 2251
gi 19113373      --------------------------------------------------------------------------------
gi 19113372      --------------------------------------------------------------------------------
                       2410      2420      2430      2440      2450      2460      2470      2480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  2372 DSNWSQPffiknvgvtylkvlknsrhkllkieilldkatifirikdgg--drwpfsirnfsdhdfifyqrdprkvsdpyk 2449
gi 19074146 1838 ---GTIP------------------------------------------------------------------------- 1841
gi 19113592 2252 NNHWTSPflaqnvgivhlkafefddddnnmsttllrlcvtledatffvtitkedkawpfrlknctsreicyeqkrpdpes 2331
gi 19113373 2006 DNTFSTP------------------------------------------------------------------------- 2012
gi 19113372      --------------------------------------------------------------------------------
                       2490      2500      2510      2520      2530      2540      2550      2560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  2450 ddqsnesssrSFKpifyripsksimpyawdfptakekylvlesgtrtrevrlaeigelpplrLdkrskdkpapiVGLHVV 2529
gi 19074146 1842 -------------------------------------------------------------------------------E 1842
gi 19113592 2332 vdsrflqgsrSMKyalnpgeeanyswdfpilkskll---qvevgkaihdldissvgqlepwhPteld----qkiRIHPEV 2404
gi 19113373 2013 ----------ACR-------------------------------------------------F----------------A 2017
gi 19113372    1 --------------------------------------------------------------------------DPSKAV 6
                       2570      2580      2590      2600      2610      2620      2630      2640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  2530 ADDDMQALVIVNyKANVGLYKLKTASATTTSSvsvnssvtdgfvqkdedekvntqiVVSFKGVGISLINGRLQELLYINM 2609
gi 19074146 1843 SESRAYLNIVVD---DLAVSLVDKGGDEILCG------------------------HLRGLEVTIERISRAMRAQREKLV 1895
gi 19113592 2405 KVDSLTSLVTFN-EIDLSKPKLPSRTNSNVKGsiveq---------------kfklVLQLKGFGISLIDKKYEEFAYATL 2468
gi 19113373 2018 ANAELKSQTISN--H-YPFMHITISALLEVKN-------------------------LLPIDLNIRIID-KDQEGVWMSN 2068
gi 19113372    7 RKPKIYSKVSTE-ERDFNLEQFDSGIDLSVK--------------------------FLLEGIGISLVERNTQELAYLTF 59
                       2650      2660      2670      2680      2690      2700      2710      2720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  2610 RGIELRYNESKAYQTFSWKMKWMQIDNQLFSGNYSNILYPTEIPYTEKEIENHPVISG--SISKVNDSLQAVPYFKHVTL 2687
gi 19074146 1896 TEYAEWIIST--------VIESVQVDNQNVLCVFPVIFHPLDKDLR---IGAKRRGSR--KFLVFELAVGDSTHHVSVSN 1962
gi 19113592 2469 KNFTFRFDDSKDLNTFGMSLGWLQIDNQMLDSVYPIALFPTMITQEVKQDDPQLLQLR---FSVLKDSSFNILYIKYASL 2545
gi 19113373 2069 VGIG--------------ECAYVHSIN-----ISHVLLLQAESS------ESHYLPSS---LATIITNDSAQERDEYMTI 2120
gi 19113372   60 HGINLFFTDSHLIRTFKLDVRWIQIDNQLYGGIYPIILYPSILSQEDTMNDNSLLPTFhsMVAVVKNDTYGVTYVKYATI 139
                       2730      2740      2750      2760      2770      2780      2790      2800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  2688 LIQEFSIQLDEDMLYAMMDFIK--FPGSPWiMDsrDYKYDEEIQLPDVSELKTAGDIYFEIFHIQPTVLHLSFIRSDEIS 2765
gi 19074146 1963 VYCRV-----QDFALNIEESLA--------------KKVSKMFEVKEHAPRGHGRNIRIQNLKMERLRAKVNFLKDVESD 2023
gi 19113592 2546 LLQELSLEVEDRLVLTLLQLLYpsSDVSKDsASlsKNAFADKFEIPDLDADVYRSNVFFETLHLQPTRLNISFETSYE-- 2623
gi 19113373 2121 TLQGG--R-KTRLGLSYTEKYP-----GIY---------HIEIFSPYIIINKSGS---FLFVGPKNDYNRISFSSASLSS 2180
gi 19113372  140 LLQELTIEIDEDFAFAALEYIKdsVPRSKR-NT--GKMFDDSLELVPENLGNDLK-VYFEVLNLQPTEMHLSFVRTERIN 215
                       2810      2820      2830      2840      2850      2860      2870      2880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  2766 PGLAEETEESFSSSLYYVhMFAMTLGNINEAPVKVNSLFMDNVRVPLPILMDHIERHYTTQFVYQIHKILGSADCFGNPV 2845
gi 19074146 2024 FISSVTGFLINNISDFSL---------------EMDGMKESCLYTTAEELRSLLASFYLSQFRRNLYKVLTHFDLIGNIG 2088
gi 19113592 2624 -SDQPAVKSSNPTLDFMTgILISTLGNIHDAPVQLNSILLENARGTLSEMANRVASHYKQQVGYQIYKIAGRADFLGNPV 2702
gi 19113373 2181 GEDGKVVPCMFSYSHNYG------S--------RRCRLRADNSNWSEPVSFDAIGSVF--EVELPSKEDHNKVYRLG--- 2241
gi 19113372  216 NTDGTVVSSHNPFVFFVN-VLSMAIGNINDAPVRLNALLMDNAHVSLRRLFELVKNHYSQELLSQVHKIVGSADFLGNPV 294
                       2890      2900      2910      2920      2930      2940      2950      2960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  2846 GLFNTISSGVWDLFYEPYQGYMMNDRPQEIGIHLAKGGLSFAKKTVFGLSDSMSKFTGSMAKGLS-VTQDLEFQRVR--- 2921
gi 19074146 2089 SFTESVSVGIKDLFVEPTLSRTNVA------RGIAKGGKSFLKNTIYGVSNTVGKFSKSIGTGARlVGCNIELRHAKghh 2162
gi 19113592 2703 GLFNNVASGVFDMFYEPYQGFLLQD-SQSFGDSFARGTSSFMRKTIYGVSDSVSKITGTISKGLStMTMDPKYQNSR--- 2778
gi 19113373 2242 IFVETGPDGYSKTNIVTITSRFIVRNKTRWSLVIAEPYNDFIAEIAPEGEEFLTYLRKHSHPMLKlSSSDCYLWSS---- 2317
gi 19113372  295 GLFTTITSGFADIFYEPFHGFILNEGSYELGIGFAKGTASFIKKAVFGITDSISKVTGTISRSLSvITLDPKFQSRR--- 371
                       2970      2980      2990      3000      3010      3020      3030      3040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  2922 -------RLQQRIN--KNNRNALANSAQSFASTLGSGLSGIALDPYKAMQKEGAAGFLK-GLGKGIVGLPTKTAIGFLDL 2991
gi 19074146 2163 syacdvhLLVPRSKhsKGSVVSILRGTGDLFDSITRGIAGIATSPIEGASQ-GVTGVVK-GLGKGILGAFTRPIVEVADL 2240
gi 19113592 2779 -------RRFRSRNrpKEAVYGVTAGANSFYDSMSSGFKGLK-KPFTDPKNNSAGKFLK-GFGKGMLGLATKPAIGLLDM 2849
gi 19113373 2318 ----------------S--FYIEEIGSTHVRLMTSEGEKLLRLEIVIKNATIFISIFEEtGDWPYYIKNESGVLLKFWQV 2379
gi 19113372  372 -------RAARIRNrpVHILYGVTAGAASLYTGVRSGVRGLALQPIIGARRNGLPGLVK-GLGKGLVGFTTKPLVGLFDF 443
                       3050      3060      3070      3080      3090      3100      3110      3120
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 2499125  2992 TSNLSQGVKSTTTVLDMQKGCRVRLPRYVDHDQIIKPYDLREAQGQYWLKTVNGGVFMNDEYLSHVILPGkeLAVIVSMQ 3071
gi 19074146 2241 VT----GISDTIKVSMDGRIKRLQYPRPR---GFVGWYDEGMSQG-FYIFMFIVKKVNEEERFVDGTFGN------FNGK 2306
gi 19113592 2850 TSNVSEGIRNSTDVRTNPEIDKVRVPRYVEFGGLIVPFKPYESLGKYMLSCLDDGKYAFDEYLYHAEIQN--VDILYIST 2927
gi 19113373 2380 NPIDASEGKNNTALLKYHDIPPHSEVKYSWDYPCCANKEIALCYGDQKCLTTLAEIGPLSPFKFTDASNN--T-KFISRD 2456
gi 19113372  444 ASSISEGARNTTTVFDERHIEKLRLSRLMSDDGVVYPFQLREALGQYWLKHLDNGRYFKDFYKAHIIIENk-VLVILTNN 522
                       3130      3140      3150      3160      3170      3180      3190
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 2499125  3072 HIAEVQMATQELMWSTGYPSIQGITLERSGLQIKLKSQSEYFIPISDPEERRSLYR--NIAIAVREYNKYCEAIL 3144
gi 19074146 2307 CHLILTTKRLLVSDTISILDVQLRSIVVEESNHKLMVG-ELCMSVEKPSFVASVKS--VVEGARPESI------- 2371
gi 19113592 2928 KHFIITGSNYIVKIAVPVKQISGLRVSEHDLNSSCLFTFAVFWQRCESLFDCEYLStpNLELFVKEKKKPIMSIT 3002
gi 19113373 2457 IVANGLSKILILKDYDPSKAVRKPKIYSKVSTEERDFNLEQFDSGID---------------------------- 2503
gi 19113372  523 RILFVQPQQLNCKKEIHLSKVKTVKLQSKEHIFLQLLKGVNFEFSVPENSVRTFFYrkIRDELAAYKHKVNYELE 597
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap