Conserved Protein Domain Family
Rnb

?
COG4776: Rnb 
Exoribonuclease II [Transcription]
Statistics
?
PSSM-Id: 227117
Aligned: 9 rows
Threshold Bit Score: 1149.13
Threshold Setting Gi: 15601560
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15601560   1 MFQDNPLLAQLKQKIQETLPKKEGTIKASDKGFGFLEVDSKTSYFVPPPYMKKCMHGDKVVAFIRTENEREVAEPSELIE 80  Vibrio cholerae
11134315   1 MFQNNPLLTQLKKNLHAKSPRVEGIVKSTERGFGFLEVDPQKSYFIPPKNMKNVMHGDKIIALLTTEKDREIVEPEKLIE 80  Buchnera aphidicola...
15831113   1 MFQDNPLLAQLKQQLHSQTPRAEGVVKATEKGFGFLEVDAQKSYFIPPPQMKKVMHGDRIIAVIHSEKERESAEPEELVE 80  Escherichia coli O1...
1173092    1 MFQDNPLLAQLKQQIHDSKEQVEGVVKSTDKAYGFLECD-KKTYFIAPPSMKKVMHGDKIKATIEKQGDKEQAEPEALIE 79  Haemophilus influenzae
15602046   1 MFQNNPLLSQLKQQIRDSKQQVEGIVKGSDKAFGFLECD-KKSYFIPPAAMKKVMHGDKIKALIEVVGEKEQAEPDALIE 79  Pasteurella multocida
16765046   1 MFQDNPLLAQLKQQLHSQTPRAEGVVKATEKGFGFLEVDAQKSYFIPPPQMKKVMHGDRIVAVIHTEKERESAEPEELIE 80  Salmonella typhimur...
16122464   1 MFQDNPLLAQLKQQLHTQTPRVEGVVKGTEKGFGFLEVDGQKSYFIPPPQMKKVMHGDRIIATLHTDKDREIAEPETLVE 80  Yersinia pestis
15801890   1 MFQDNPLLAQLKQQLHSQTPRXEGVVKATEKGFGFLEVDAQKSYFIPPPQMKKVMHGDRIIAVIHSEKERESAEPEELVE 80  Escherichia coli O1...
2507333    1 MFQDNPLLAQLKQQLHSQTPRAEGVVKATEKGFGFLEVDAQKSYFIPPPQMKKVMHGDRIIAVIHSEKERESAEPEELVE 80  Escherichia coli
11134315   1 MFQNNPLLTQLKKNLHAKSPRVEGIVKSTERGFGFLEVDPQKSYFIPPKNMKNVMHGDKIIALLTTEKDREIVEPEKLIE 80  Buchnera aphidicola...
15831113   1 MFQDNPLLAQLKQQLHSQTPRAEGVVKATEKGFGFLEVDAQKSYFIPPPQMKKVMHGDRIIAVIHSEKERESAEPEELVE 80  Escherichia coli O1...
1173092    1 MFQDNPLLAQLKQQIHDSKEQVEGVVKSTDKAYGFLECD-KKTYFIAPPSMKKVMHGDKIKATIEKQGDKEQAEPEALIE 79  Haemophilus influenzae
15602046   1 MFQNNPLLSQLKQQIRDSKQQVEGIVKGSDKAFGFLECD-KKSYFIPPAAMKKVMHGDKIKALIEVVGEKEQAEPDALIE 79  Pasteurella multocida
16765046   1 MFQDNPLLAQLKQQLHSQTPRAEGVVKATEKGFGFLEVDAQKSYFIPPPQMKKVMHGDRIVAVIHTEKERESAEPEELIE 80  Salmonella typhimur...
16122464   1 MFQDNPLLAQLKQQLHTQTPRVEGVVKGTEKGFGFLEVDGQKSYFIPPPQMKKVMHGDRIIATLHTDKDREIAEPETLVE 80  Yersinia pestis
15801890   1 MFQDNPLLAQLKQQLHSQTPRXEGVVKATEKGFGFLEVDAQKSYFIPPPQMKKVMHGDRIIAVIHSEKERESAEPEELVE 80  Escherichia coli O1...
2507333    1 MFQDNPLLAQLKQQLHSQTPRAEGVVKATEKGFGFLEVDAQKSYFIPPPQMKKVMHGDRIIAVIHSEKERESAEPEELVE 80  Escherichia coli
15601560  81 QSLTRFIGRVKL-FKGKLNVAPDHPQLKKLsLKAKTKKGLNEaDFQEGDWVVAHLVRHPLKGDDGFFVQISHKITDANDK 159 Vibrio cholerae
11134315  81 PFLNRFVGKIEK-KDNRLFIVPDYPFLKDL-ITCQPNKNCIN-IFQNGDWAVAQLKKHKLKGDHLFYAELTEKITQEDDP 157 Buchnera aphidicola...
15831113  81 PFLTRFVGKVQG-KNDRLAIVPDHPLLKDA-IPCRAARGLNH-EFKEGDWAVAEMRRHPLKGDRSFYAELTQYITFGDDH 157 Escherichia coli O1...
1173092   80 PMLTRFIAKVRFnKDKKLQVLVDHPSINQP-IGAQQAKSVKE-ELQEGDWVVANLKTHPLRDDRFFYATINQLICRADDE 157 Haemophilus influenzae
15602046  80 PMLTRFIARVRFnKDKKLQVLVDHPQINQA-IGAAQDKSITE-TLQEGDWVVATLKTHPLRDDRFFFAQIQQFICRAEDE 157 Pasteurella multocida
16765046  81 PFLTRFVGKVQG-KNDRLSIVPDHPLLKDA-IPCRAARGVQH-EFKEGDWAVAEMRRHPLKGDRSFYADLTQYITFADDH 157 Salmonella typhimur...
16122464  81 PFLSRFVGRVQR-KDDRLSIVPDHPLLRDA-IQCRPVRELTH-SFQNGDWAVAEMCRHPLKGDRAFQADLTAFITNGEDH 157 Yersinia pestis
15801890  81 PFLTRFVGKVQG-KNDRLAIVPDHPLLKDA-IPCRAARGLNH-EFKEGDWAVAEMRRHPLKGDRSFYAELTQYITFGDDH 157 Escherichia coli O1...
2507333   81 PFLTRFVGKVQG-KNDRLAIVPDHPLLKDA-IPCRAARGLNH-EFKEGDWAVAEMRRHPLKGDRSFYAELTQYITFGDDH 157 Escherichia coli
11134315  81 PFLNRFVGKIEK-KDNRLFIVPDYPFLKDL-ITCQPNKNCIN-IFQNGDWAVAQLKKHKLKGDHLFYAELTEKITQEDDP 157 Buchnera aphidicola...
15831113  81 PFLTRFVGKVQG-KNDRLAIVPDHPLLKDA-IPCRAARGLNH-EFKEGDWAVAEMRRHPLKGDRSFYAELTQYITFGDDH 157 Escherichia coli O1...
1173092   80 PMLTRFIAKVRFnKDKKLQVLVDHPSINQP-IGAQQAKSVKE-ELQEGDWVVANLKTHPLRDDRFFYATINQLICRADDE 157 Haemophilus influenzae
15602046  80 PMLTRFIARVRFnKDKKLQVLVDHPQINQA-IGAAQDKSITE-TLQEGDWVVATLKTHPLRDDRFFFAQIQQFICRAEDE 157 Pasteurella multocida
16765046  81 PFLTRFVGKVQG-KNDRLSIVPDHPLLKDA-IPCRAARGVQH-EFKEGDWAVAEMRRHPLKGDRSFYADLTQYITFADDH 157 Salmonella typhimur...
16122464  81 PFLSRFVGRVQR-KDDRLSIVPDHPLLRDA-IQCRPVRELTH-SFQNGDWAVAEMCRHPLKGDRAFQADLTAFITNGEDH 157 Yersinia pestis
15801890  81 PFLTRFVGKVQG-KNDRLAIVPDHPLLKDA-IPCRAARGLNH-EFKEGDWAVAEMRRHPLKGDRSFYAELTQYITFGDDH 157 Escherichia coli O1...
2507333   81 PFLTRFVGKVQG-KNDRLAIVPDHPLLKDA-IPCRAARGLNH-EFKEGDWAVAEMRRHPLKGDRSFYAELTQYITFGDDH 157 Escherichia coli
15601560 160 IAPWWVTLAENDLPNSEPAGIDDWQLKDDAdLVREDLTALPFVTIDGESTKDMDDALYAQQLPNGD----FALTIAIADP 235 Vibrio cholerae
11134315 158 LIPWWVTLARHDLDRKEPLAEDDDLILKES-DNRKDLTDLDFITIDNTNTKDIDDALFVSEKNNGD----ISLIVAIADP 232 Buchnera aphidicola...
15831113 158 FVPWWVTLARHNLEKEAPDG-VATEMLDEG-LVRKDLTALDFVTIDSASTEDMDDALFAKALPDDK----LQLIVAIADP 231 Escherichia coli O1...
1173092  158 LAPWWVTLARHEQSRYPVRGAEPYEMLDQK--TRENLTALHFVTIDSESTMDMDDALYIEPIAQNStqtgWKLVVAIADP 235 Haemophilus influenzae
15602046 158 LAPWWVTLARHGQSRYPVQGCADYPMIDQH--TREDLTALHFITIDAETTLDMDDALYLEPIHQAEeqigWRLVVAVADP 235 Pasteurella multocida
16765046 158 FVPWWVTLARHNLEKEAPNG-VATEMLDEG-LERQDLTALNFVTIDSASTEDMDDALYAEELADGR----LQLTVAIADP 231 Salmonella typhimur...
16122464 158 FVPWWVTLARHNLEREAPAM-VESALNDAE-LEREDLTALNFVTIDSASTEDMDDALFVQDNGDGS----WLLTIAIADP 231 Yersinia pestis
15801890 158 FVPWWVTLARHNLEKEAPDG-VATEMLDEG-LVRKDLTALDFVTIDSASTEDMDDALFAKALPDDK----LQLIVAIADP 231 Escherichia coli O1...
2507333  158 FVPWWVTLARHNLEKEAPDG-VATEMLDEG-LVREDLTALDFVTIDSASTEDMDDALFAKALPDDK----LQLIVAIADP 231 Escherichia coli
11134315 158 LIPWWVTLARHDLDRKEPLAEDDDLILKES-DNRKDLTDLDFITIDNTNTKDIDDALFVSEKNNGD----ISLIVAIADP 232 Buchnera aphidicola...
15831113 158 FVPWWVTLARHNLEKEAPDG-VATEMLDEG-LVRKDLTALDFVTIDSASTEDMDDALFAKALPDDK----LQLIVAIADP 231 Escherichia coli O1...
1173092  158 LAPWWVTLARHEQSRYPVRGAEPYEMLDQK--TRENLTALHFVTIDSESTMDMDDALYIEPIAQNStqtgWKLVVAIADP 235 Haemophilus influenzae
15602046 158 LAPWWVTLARHGQSRYPVQGCADYPMIDQH--TREDLTALHFITIDAETTLDMDDALYLEPIHQAEeqigWRLVVAVADP 235 Pasteurella multocida
16765046 158 FVPWWVTLARHNLEKEAPNG-VATEMLDEG-LERQDLTALNFVTIDSASTEDMDDALYAEELADGR----LQLTVAIADP 231 Salmonella typhimur...
16122464 158 FVPWWVTLARHNLEREAPAM-VESALNDAE-LEREDLTALNFVTIDSASTEDMDDALFVQDNGDGS----WLLTIAIADP 231 Yersinia pestis
15801890 158 FVPWWVTLARHNLEKEAPDG-VATEMLDEG-LVRKDLTALDFVTIDSASTEDMDDALFAKALPDDK----LQLIVAIADP 231 Escherichia coli O1...
2507333  158 FVPWWVTLARHNLEKEAPDG-VATEMLDEG-LVREDLTALDFVTIDSASTEDMDDALFAKALPDDK----LQLIVAIADP 231 Escherichia coli
15601560 236 TAYITPEDEMDKVARERGFTIYLPGRNIPMLPRDLADELCSLMENQVRPALCCSVTIRKDGVIGDDIRFFAANIKSHARL 315 Vibrio cholerae
11134315 233 TAYIKHGSKLDVIASKRIFTNYLPGFNIPMLPRNLSEDICSLNPNKRRPVLACHITVLKNGNISNKIEFFLAWIKSKSKL 312 Buchnera aphidicola...
15831113 232 TAWIAEGSKLDKAAKIRAFTNYLPGFNIPMLPRELSDDLCSLRANEVRPVLACRMTLSADGTIEDNIEFFAATIESKAKL 311 Escherichia coli O1...
1173092  236 TAYIALDSQIEQEAKQRCFTNYLPGFNIPMLPRELSDELCSLIANETRPALVCYIETDLTGNITAKPHFVSAYVQSKAKL 315 Haemophilus influenzae
15602046 236 TAYIPLDSQIEQEARQRCFTNYLPGFNIPMLPPELSDERCSLMQDEIRPALVCYIETDLTGNITEKPRFVSAYVQSKAKL 315 Pasteurella multocida
16765046 232 TAWIAEGSKLDNTAKIRAFTNYLPGFNIPMLPRELSDDLCSLRANEVRPALACRMIIAADGTIDDDIAFFAATIESKAKL 311 Salmonella typhimur...
16122464 232 TAYVVENSELDLTARKRAFTNYLPGFNIPMLPRDLSDNLCSLRPNERRPVLVCRVTITEEGTLSNDIRFSAAWVESKAKL 311 Yersinia pestis
15801890 232 TAWIAEGSKLDKAAKIRAFTNYLPGFNIPMLPRELSDDLCSLRANEVRPVLACRMTLSADGTIEDNIEFFAATIESKAKL 311 Escherichia coli O1...
2507333  232 TAWIAEGSKLDKAAKIRAFTNYLPGFNIPMLPRELSDDLCSLRANEVRPVLACRMTLSADGTIEDNIEFFAATIESKAKL 311 Escherichia coli
11134315 233 TAYIKHGSKLDVIASKRIFTNYLPGFNIPMLPRNLSEDICSLNPNKRRPVLACHITVLKNGNISNKIEFFLAWIKSKSKL 312 Buchnera aphidicola...
15831113 232 TAWIAEGSKLDKAAKIRAFTNYLPGFNIPMLPRELSDDLCSLRANEVRPVLACRMTLSADGTIEDNIEFFAATIESKAKL 311 Escherichia coli O1...
1173092  236 TAYIALDSQIEQEAKQRCFTNYLPGFNIPMLPRELSDELCSLIANETRPALVCYIETDLTGNITAKPHFVSAYVQSKAKL 315 Haemophilus influenzae
15602046 236 TAYIPLDSQIEQEARQRCFTNYLPGFNIPMLPPELSDERCSLMQDEIRPALVCYIETDLTGNITEKPRFVSAYVQSKAKL 315 Pasteurella multocida
16765046 232 TAWIAEGSKLDNTAKIRAFTNYLPGFNIPMLPRELSDDLCSLRANEVRPALACRMIIAADGTIDDDIAFFAATIESKAKL 311 Salmonella typhimur...
16122464 232 TAYVVENSELDLTARKRAFTNYLPGFNIPMLPRDLSDNLCSLRPNERRPVLVCRVTITEEGTLSNDIRFSAAWVESKAKL 311 Yersinia pestis
15801890 232 TAWIAEGSKLDKAAKIRAFTNYLPGFNIPMLPRELSDDLCSLRANEVRPVLACRMTLSADGTIEDNIEFFAATIESKAKL 311 Escherichia coli O1...
2507333  232 TAWIAEGSKLDKAAKIRAFTNYLPGFNIPMLPRELSDDLCSLRANEVRPVLACRMTLSADGTIEDNIEFFAATIESKAKL 311 Escherichia coli
15601560 316 VYDHVSDWLETGSSeqWQP-SEEIAQVVRDLYAFSQARANWRETHAVVFPDRPDYRFELSADNDVVAIHADMRRTANRLV 394 Vibrio cholerae
11134315 313 SYDHVSDWIEKIGS--WIPpTKSIANQILILHRLCLLRIKWRKKNAVLFKDSIEYRFHVSEHGKIIDVLIEKRRIAHKII 390 Buchnera aphidicola...
15831113 312 VYDQVSDWLENTGD--WQPeSEAIAEQVRLLAQICQRRGEWRHNHALVFKDRPDYRFILGEKGEVLDIVAEPRRIANRIV 389 Escherichia coli O1...
1173092  316 AYNKVSDYLEQADNa-WQPeMPETAQQIHWLHQFTKARIQWRKTHSLFFKEKPDYAFVLAENGKVQEIKAEYRRIANQIV 394 Haemophilus influenzae
15602046 316 AYDHVSDYLENCLDa-WQPeNPQIAQQIQWLHQFTQARIEWRKQHALLFKEKPDYSFILAENGSVQAIQAQYRRIANQMV 394 Pasteurella multocida
16765046 312 AYDNVSDWLENNGT--WQPdNEGIAQQIRLLHRICLSRSEWRHHHALVFKDRPDYRFVLGEKGEVLDIVAEPRRIANRIV 389 Salmonella typhimur...
16122464 312 VYDDVSDWLEGNNR--WQPqDTAIAEQITLLKRICDARSNWRQQHALVFKDRPDYRFLLGEKGEVLDIIVEHRRIANRIV 389 Yersinia pestis
15801890 312 VYDQVSDWLENTGD--WQPeSEAIAEQVRLLAQICQRRGEWRHNHALVFKDRPDYRFILGEKGEVLDIVAEPRRIANRIV 389 Escherichia coli O1...
2507333  312 VYDQVSDWLENTGD--WQPeSEAIAEQVRLLAQICQRRGEWRHNHALVFKDRPDYRFILGEKGEVLDIVAEPRRIANRIV 389 Escherichia coli
11134315 313 SYDHVSDWIEKIGS--WIPpTKSIANQILILHRLCLLRIKWRKKNAVLFKDSIEYRFHVSEHGKIIDVLIEKRRIAHKII 390 Buchnera aphidicola...
15831113 312 VYDQVSDWLENTGD--WQPeSEAIAEQVRLLAQICQRRGEWRHNHALVFKDRPDYRFILGEKGEVLDIVAEPRRIANRIV 389 Escherichia coli O1...
1173092  316 AYNKVSDYLEQADNa-WQPeMPETAQQIHWLHQFTKARIQWRKTHSLFFKEKPDYAFVLAENGKVQEIKAEYRRIANQIV 394 Haemophilus influenzae
15602046 316 AYDHVSDYLENCLDa-WQPeNPQIAQQIQWLHQFTQARIEWRKQHALLFKEKPDYSFILAENGSVQAIQAQYRRIANQMV 394 Pasteurella multocida
16765046 312 AYDNVSDWLENNGT--WQPdNEGIAQQIRLLHRICLSRSEWRHHHALVFKDRPDYRFVLGEKGEVLDIVAEPRRIANRIV 389 Salmonella typhimur...
16122464 312 VYDDVSDWLEGNNR--WQPqDTAIAEQITLLKRICDARSNWRQQHALVFKDRPDYRFLLGEKGEVLDIIVEHRRIANRIV 389 Yersinia pestis
15801890 312 VYDQVSDWLENTGD--WQPeSEAIAEQVRLLAQICQRRGEWRHNHALVFKDRPDYRFILGEKGEVLDIVAEPRRIANRIV 389 Escherichia coli O1...
2507333  312 VYDQVSDWLENTGD--WQPeSEAIAEQVRLLAQICQRRGEWRHNHALVFKDRPDYRFILGEKGEVLDIVAEPRRIANRIV 389 Escherichia coli
15601560 395 EESMITANICAGKTLQTTFGFGVFNTHAGFKAEKMADVVELMAVNGAp---------NADAETLATVEGFAALRRWLATQ 465 Vibrio cholerae
11134315 391 EESMIVANISAANFLSKNIGFGIYNVHSGFDLVNAENAVSFLRSYNL----------NFTVKEITTLKGFCNLRRVLNII 460 Buchnera aphidicola...
15831113 390 EEAMIAANICAARVLRDKLGFGIYNVHMGFDPANADALAALLKTHGL----------HVDAEEVLTLDGFCKLRRELDAQ 459 Escherichia coli O1...
1173092  395 EEAMIIANICAAQFLHEQAKTGIFNTHSGFDKKFLENAHNFLMANLAneqnqtelaeRYSVENLATLNGYCQMRHDIEPI 474 Haemophilus influenzae
15602046 395 EECMILANICAAHYLDEHAKCGIFNTHSGFDKKYLESAHQFLLNQLSdetnqavlatRYSVANLTTLAGYCQMRHDIELL 474 Pasteurella multocida
16765046 390 EESMIAANLCAARVLRDKLGFGIYNVHTGFDPANADALAALLKTHGL----------HVDAEEVLTLEGFCKLRRELDAQ 459 Salmonella typhimur...
16122464 390 EECMIAANVCAALALREHLGFGIYNVHTGFDPALVEQAASVLKANGV----------GADPQALLTLPGFCELRRHLDAL 459 Yersinia pestis
15801890 390 EEAMIAANICAARVLRDKLGFGIYNVHMGFDPANADALAALLKTHGL----------HVDAEEVLTLDGFCKLRRELDAQ 459 Escherichia coli O1...
2507333  390 EEAMIAANICAARVLRDKLGFGIYNVHMGFDPANADALAALLKTHGL----------HVDAEEVLTLDGFCKLRRELDAQ 459 Escherichia coli
11134315 391 EESMIVANISAANFLSKNIGFGIYNVHSGFDLVNAENAVSFLRSYNL----------NFTVKEITTLKGFCNLRRVLNII 460 Buchnera aphidicola...
15831113 390 EEAMIAANICAARVLRDKLGFGIYNVHMGFDPANADALAALLKTHGL----------HVDAEEVLTLDGFCKLRRELDAQ 459 Escherichia coli O1...
1173092  395 EEAMIIANICAAQFLHEQAKTGIFNTHSGFDKKFLENAHNFLMANLAneqnqtelaeRYSVENLATLNGYCQMRHDIEPI 474 Haemophilus influenzae
15602046 395 EECMILANICAAHYLDEHAKCGIFNTHSGFDKKYLESAHQFLLNQLSdetnqavlatRYSVANLTTLAGYCQMRHDIELL 474 Pasteurella multocida
16765046 390 EESMIAANLCAARVLRDKLGFGIYNVHTGFDPANADALAALLKTHGL----------HVDAEEVLTLEGFCKLRRELDAQ 459 Salmonella typhimur...
16122464 390 EECMIAANVCAALALREHLGFGIYNVHTGFDPALVEQAASVLKANGV----------GADPQALLTLPGFCELRRHLDAL 459 Yersinia pestis
15801890 390 EEAMIAANICAARVLRDKLGFGIYNVHMGFDPANADALAALLKTHGL----------HVDAEEVLTLDGFCKLRRELDAQ 459 Escherichia coli O1...
2507333  390 EEAMIAANICAARVLRDKLGFGIYNVHMGFDPANADALAALLKTHGL----------HVDAEEVLTLDGFCKLRRELDAQ 459 Escherichia coli
15601560 466 ETSYLDNRIRKYQSYSEIGNQPLPHFAMGLDVYATWTSPIRKYGDMINHRLLKAHILGKAPVQtPDETVGEELALHRKHH 545 Vibrio cholerae
11134315 461 SNNYIDSRIRRFQSFGDFSTIPGPHFALGFSEYATWTSPIRKYSDMINHRLLKSIIKKEKSIK-PGEDIKIKISEQRRRN 539 Buchnera aphidicola...
15831113 460 PTGFLDSRIRRFQSFAEISTEPGPHFGLGLEAYATWTSPIRKYGDMINHRLLKAVIKGETATR-PQDEITVQMAERRRLN 538 Escherichia coli O1...
1173092  475 ESDYLELRLRRYLTFAEFKSELAPHFGLGLEGYATWTSPIRKYSDMVNHRLIKAVLAKQPYEK-PQNDVLARLQEARRQN 553 Haemophilus influenzae
15602046 475 NSDYLELRLRRFLTFAEFKSEIAPHFGLGLSGYATWTSPIRKYSDMVNHRLIKAVLTQQTCEK-PQDDLFVRLQEARRQN 553 Pasteurella multocida
16765046 460 PSGFLDSRIRRFQSFAEISTEPGPHFGLGLEAYATWTSPIRKYGDMINHRLLKAVIKGEAIAR-PQEDITQQMAERRRLN 538 Salmonella typhimur...
16122464 460 PTQFLDSRIRRFQTFAEISTVPGPHFGLGLEAYATWTSPIRKYGDMVNHRLLKAMITGQQAEK-PQEEITVQLAERRRLN 538 Yersinia pestis
15801890 460 PTGFLDSRIRRFQSFAEISTEPGPHFGLGLEAYATWTSPIRKYGDMINHRLLKAVIKGETATR-PQDEITVQMAERRRLN 538 Escherichia coli O1...
2507333  460 PTGFLDSRIRRFQSFAEISTEPGPHFGLGLEAYATWTSPIRKYGDMINHRLLKAVIKGETATR-PQDEITVQMAERRRLN 538 Escherichia coli
11134315 461 SNNYIDSRIRRFQSFGDFSTIPGPHFALGFSEYATWTSPIRKYSDMINHRLLKSIIKKEKSIK-PGEDIKIKISEQRRRN 539 Buchnera aphidicola...
15831113 460 PTGFLDSRIRRFQSFAEISTEPGPHFGLGLEAYATWTSPIRKYGDMINHRLLKAVIKGETATR-PQDEITVQMAERRRLN 538 Escherichia coli O1...
1173092  475 ESDYLELRLRRYLTFAEFKSELAPHFGLGLEGYATWTSPIRKYSDMVNHRLIKAVLAKQPYEK-PQNDVLARLQEARRQN 553 Haemophilus influenzae
15602046 475 NSDYLELRLRRFLTFAEFKSEIAPHFGLGLSGYATWTSPIRKYSDMVNHRLIKAVLTQQTCEK-PQDDLFVRLQEARRQN 553 Pasteurella multocida
16765046 460 PSGFLDSRIRRFQSFAEISTEPGPHFGLGLEAYATWTSPIRKYGDMINHRLLKAVIKGEAIAR-PQEDITQQMAERRRLN 538 Salmonella typhimur...
16122464 460 PTQFLDSRIRRFQTFAEISTVPGPHFGLGLEAYATWTSPIRKYGDMVNHRLLKAMITGQQAEK-PQEEITVQLAERRRLN 538 Yersinia pestis
15801890 460 PTGFLDSRIRRFQSFAEISTEPGPHFGLGLEAYATWTSPIRKYGDMINHRLLKAVIKGETATR-PQDEITVQMAERRRLN 538 Escherichia coli O1...
2507333  460 PTGFLDSRIRRFQSFAEISTEPGPHFGLGLEAYATWTSPIRKYGDMINHRLLKAVIKGETATR-PQDEITVQMAERRRLN 538 Escherichia coli
15601560 546 KIAERNVADWLYARTLADEPAKETRFQAEIFDINRPGMRVRLLENGAMAFIPGALILDNKERIECNGEDGTVLIDKEVVY 625 Vibrio cholerae
11134315 540 RMAERDVLDWLYTIFLQKKKYQNQKFNAEITDISRSGIRARLIENGANVFIPGTLIHPIREELNFNQESGKVFINGIMHY 619 Buchnera aphidicola...
15831113 539 RMAERDVGDWLYARFLKDKAGTDTRFAAEIVDISRGGMRVRLVDNGAIAFIPAPFLHAVRDELVCSQENGTVQIKGETVY 618 Escherichia coli O1...
1173092  554 RLVERDIADWLYCRYLADKVASNAEFEAEVQDVMRAGLRVQLLENGASLFIPAATLHNNKEEIQLNPDELALYIKGERTY 633 Haemophilus influenzae
15602046 554 RLVERDIADWLYCRYLATQVEQKPTFQAEIQDVMRGGLRVQLLANGAPMFIPASLIHDNKEAIQVNTDTLTLSIQGEVKY 633 Pasteurella multocida
16765046 539 RMAERDVGDWLYARFLNDKAGTNTRFAAEIIDVSRGGMRVRLVDNGAIAFIPAPFLHAVRDELVCSQENGTVQIKGETVY 618 Salmonella typhimur...
16122464 539 RMAERDVGDWLYARYLQPQAGTDTRFTAEIIDITRGGLRVRLLDNGAVAFIPAPFIHAVRDEVVCSQETGTVQIKGETVY 618 Yersinia pestis
15801890 539 RMAERDVGDWLYARFLKDKAGTDTRFAAEIVDISRGGMRVRLVDNGAIAFIPAPFLHAVRDELVCSQENGTVQIKGETVY 618 Escherichia coli O1...
2507333  539 RMAERDVGDWLYARFLKDKAGTDTRFAAEIVDISRGGMRVRLVDNGAIAFIPAPFLHAVRDELVCSQENGTVQIKGETVY 618 Escherichia coli
11134315 540 RMAERDVLDWLYTIFLQKKKYQNQKFNAEITDISRSGIRARLIENGANVFIPGTLIHPIREELNFNQESGKVFINGIMHY 619 Buchnera aphidicola...
15831113 539 RMAERDVGDWLYARFLKDKAGTDTRFAAEIVDISRGGMRVRLVDNGAIAFIPAPFLHAVRDELVCSQENGTVQIKGETVY 618 Escherichia coli O1...
1173092  554 RLVERDIADWLYCRYLADKVASNAEFEAEVQDVMRAGLRVQLLENGASLFIPAATLHNNKEEIQLNPDELALYIKGERTY 633 Haemophilus influenzae
15602046 554 RLVERDIADWLYCRYLATQVEQKPTFQAEIQDVMRGGLRVQLLANGAPMFIPASLIHDNKEAIQVNTDTLTLSIQGEVKY 633 Pasteurella multocida
16765046 539 RMAERDVGDWLYARFLNDKAGTNTRFAAEIIDVSRGGMRVRLVDNGAIAFIPAPFLHAVRDELVCSQENGTVQIKGETVY 618 Salmonella typhimur...
16122464 539 RMAERDVGDWLYARYLQPQAGTDTRFTAEIIDITRGGLRVRLLDNGAVAFIPAPFIHAVRDEVVCSQETGTVQIKGETVY 618 Yersinia pestis
15801890 539 RMAERDVGDWLYARFLKDKAGTDTRFAAEIVDISRGGMRVRLVDNGAIAFIPAPFLHAVRDELVCSQENGTVQIKGETVY 618 Escherichia coli O1...
2507333  539 RMAERDVGDWLYARFLKDKAGTDTRFAAEIVDISRGGMRVRLVDNGAIAFIPAPFLHAVRDELVCSQENGTVQIKGETVY 618 Escherichia coli
15601560 626 KLGDVLEIVLTEVNQENRSLVGKPTQ 651 Vibrio cholerae
11134315 620 KISDLIQVTLSDIRLKTRSIIAKPVF 645 Buchnera aphidicola (Acyrthosiphon pisum)
15831113 619 KVTDVIDVTIAEVRMETRSIIARPVA 644 Escherichia coli O157:H7
1173092  634 KIGDMVKVKLTEVKEATRSIVGEILQ 659 Haemophilus influenzae
15602046 634 KLGDIIQVQLLDVKEETRSIVGTLC- 658 Pasteurella multocida
16765046 619 KVTDVIDVTIAEVRMETRSIIARPAA 644 Salmonella typhimurium LT2
16122464 619 SQSDKIEVRIAEVRMETRNVIARPVA 644 Yersinia pestis
15801890 619 KVTDVIDVTIAEVRMETRSIIARPVA 644 Escherichia coli O157:H7 EDL933
2507333  619 KVTDVIDVTIAEVRMETRSIIARPVA 644 Escherichia coli
11134315 620 KISDLIQVTLSDIRLKTRSIIAKPVF 645 Buchnera aphidicola (Acyrthosiphon pisum)
15831113 619 KVTDVIDVTIAEVRMETRSIIARPVA 644 Escherichia coli O157:H7
1173092  634 KIGDMVKVKLTEVKEATRSIVGEILQ 659 Haemophilus influenzae
15602046 634 KLGDIIQVQLLDVKEETRSIVGTLC- 658 Pasteurella multocida
16765046 619 KVTDVIDVTIAEVRMETRSIIARPAA 644 Salmonella typhimurium LT2
16122464 619 SQSDKIEVRIAEVRMETRNVIARPVA 644 Yersinia pestis
15801890 619 KVTDVIDVTIAEVRMETRSIIARPVA 644 Escherichia coli O157:H7 EDL933
2507333  619 KVTDVIDVTIAEVRMETRSIIARPVA 644 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap