Conserved Protein Domain Family
LolE

?
COG4591: LolE 
ABC-type transport system, involved in lipoprotein release, permease component [Cell wall/membrane/envelope biogenesis]
Statistics
?
PSSM-Id: 226957
View PSSM: COG4591
Aligned: 53 rows
Threshold Bit Score: 88.8897
Threshold Setting Gi: 15594424
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15639570  42 LPTPVPFLSGTPVAGKRR---SFLRKSFFCAALGIGISIIPLIVVLVVSDGMIEGITTRMIELgSGHLQFIDILPlap-- 116
gi 15594424     --------------------------------------------------------------------------------
gi 15594425     --------------------------------------------------------------------------------
gi 15594427   1 MILRLPEITKIAYLIFKN---STNKIALIGSGISLSLVMIPLIIVYYMSSNIMTSTINKYIESeGFSMQIEYNET----- 72
gi 15830548  24 LFYSRDVKFAFLNLFRHKr--RSFSTITAIVLGG----VAIFLYGGFIDYSFWILKEQTIRTN-IGHVQIYNQHYfetsn 96
gi 19703916   1 ---MIEFFIAKKQMFERK-----KQSILSIVGVFIG--ITVLIVSLGVSNGLDKNMINSILSL-TSHITVYSPE------ 63
gi 15639568   7 QTLRWMCFMVRRLNSVRAr--SANAITSLFFILGIAFGALTLIVILSVMNGFQQGFIGTILQVsSAHVRVYGS------- 77
gi 15601609   4 LISQAWRLAALNLQRNRRrslLSISIIAIAVLALTSAGGFGLYTYDSLRESTARDVGHLTLSQ-RGYFAQEEETPl---- 78
gi 15801042  24 LFYSRDVKFAFLNLFRHKr--RSFSTITAIVLGG----VAIFLYGGFIDYSFWILKEQTIRTN-IGHVQIYNQHYfetsn 96
gi 15605828   1 --MRAVLFLSFKFFVERK-----RQSFIATLGVMIG--TTAYIVMSSMVNGFQKYFLEEALNI-NGHVKIFVEARekges 70
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15639570 117 --------------------netATQRYEDAQRIFN--AFMAQDFGPYCHSRWMHLQgdgiviGKTGRAGGNIRAVPPDF 174
gi 15594424     --------------------------------------------------------------------------------
gi 15594425     --------------------------------------------------------------------------------
gi 15594427  73 -----------------------NRTHYLKDRLSLLkkKHNYKDLNYFFEKRTYGIIg-----NNKKQGVLIRAIENKFI 124
gi 15830548  97 -------------------knksLIADYAALKKAILs-DPTLAADISTLSGQLEFTGvishyeSETSSYFSALGVEPLPA 156
gi 19703916  64 -----------------------NISDYEEISKDIEt-IKGVKGVVPTIETQGIVKY-------EGGIEPYVAGVKVVGY 112
gi 15639568  78 ------------------------VDAVK-RAETLG----GYQSFYPFIEAHALLQG------NYYRQHGALVRAVPADI 122
gi 15601609  79 ----------------------aNGLEGSDHIRQVLlaNPAIRGIQPRIELTGLVSN------GQKSTIFVGLGVDDKEF 130
gi 15801042  97 -------------------knksLIADYAALKKAILs-DPTLAADISTLSGQLEFTGvishyeSETSSYFSALGVEPLPA 156
gi 15605828  71 flkkffpdknfkilgekpeetkdKIANYREILRKYSq-DKNVIGITVHLIGNGVLTY------GVKEKPATFVGIIPKLE 143
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15639570 175 FSseRGLRPFLTVEGSLELVD-RPQGvhtLILGKRIAERIGVRC-GDTCQILTLVqgG--TGRAVPKMVRAVVGGIVSCG 250
gi 15594424   1 ---------------------------------------MGIRN-FLLKRLILEE----------KNSLALTIVIILSIA 30
gi 15594425     --------------------------------------------------------------------------------
gi 15594427 125 LE--NKSIKLIKGTKNLKKDS--------ILISNQIKNKLNLNL-NEKIDILIPNt---kNDKIMPRIKKFNISGIIETG 190
gi 15830548 157 L----KLGSFDKIIAGSDLSR-VKGd--eITLGSGLAKTLNAKY-DDWLDVMVVN-----T-AGGQGALSLKMRGIFESG 222
gi 19703916 113 DLekAVKTMNLDKYIIDGKID-LEDKk-aILIGNELAKATGAKV-GDKIKLITSE----------ETDLEMNVAGIFQSG 179
gi 15639568 123 FHr-DRLLARALPITSGSFNLsKKHS---IVLGYELARHLSVRT-GDQVDTLALS--GsdTQKIMPGWNKLTVTGIFKSG 195
gi 15601609 131 DMkgPFLDLRAGQTLQDPKSPrFDPTqpqVMLGVDLARNLSVGV-GDWVTLLATT------ADGALNALDFQVRGLYSTG 203
gi 15801042 157 L----KLGSFDKIIAGSDLSR-VKGd--eITLGSGLAKTLNAKY-DDWLDVMVVN-----T-AGGQGALSLKMRGIFESG 222
gi 15605828 144 DKt-LNVSKYLQEGRLNELER-NKDY---VILGIKLAQELGIREtGKKVLLYAPS-------G-E--VYRLKVIDFLNTG 208
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15639570 251 YQELDALWVFIPLTLGMKILSPASA--LLSFVVKTADAFDAKAMTRFIEQVHeqLPSHFSAYTWQDMNRSQFHSFRTSRK 328
gi 15594424  31 LGEIIIILTISIMNGFQNDFFLSITn-VESGNLKIENELTQEEIKKIKKIEG------IKHINKIYETQGIGIQNYYYPT 103
gi 15594425   1 -------MNIDYFIKNKILHNSG-----INYQVKTKNLNPSNKLIEKIKAVN----PKIKAKTWNEYNKEFYKILKIERN 64
gi 15594427 191 LKDIDNNLVLISFEN-ENLMSKKFSksIIGLKTNSNSIKNNEILKQNLETEF----QEFQIKTFYELYSNKYNNLDISKK 265
gi 15830548 223 IKDYDDVAMKIPLDTAQRMMGTD-Gv-SKVLILLKEDDTAAFSAKLRQFIER--NHLPLVVKDWRDVSLFYQQVEGLLSG 298
gi 19703916 180 FYEYDINMVLIPLTTAQYITYSDNT--VGRLSVRLDNPYNAQKLVIDVA-RK--LPETFYIGTWGEQNKALLSALTLEKT 254
gi 15639568 196 YHEVDSTFAYIPLDMGTTLFGTTPD---ITAAVKLNNHERDDRYLFFLAQH----IPDLKAESWREYNRAFFSALRIEKN 268
gi 15601609 204 VPELDKRQLYLHLASAQELLNSSKVstLSVYLFNTENTQTLQTWVENQLNQLs-LSQELQVTPWQQLAFFYTRVKDLYDR 282
gi 15801042 223 IKDYDDVAMKIPLDTAQRMMGTD-Gv-SKVLILLKEDDTAAFSAKLRQFIER--NHLPLVVKDWRDVSLFYQQVEGLLSG 298
gi 15605828 209 ITEIDKSRIYLHIKKLQDILERQGE--VNEVVLKLKDPDLAPFYAEKLS-----RETGYKAESWQESFKNFLSIFKIQKI 281
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15639570 329 LLLFIMYLIVLVASVHISSVLVVLMTERRKEIAMLKAMGAPPHVIALIFLSAGLLTALYGLLIGLPLGMWCAIHVNEMFL 408
gi 15594424 104 ILNIIAVDIKDLKKDQNFISFTGLEKDELDLKDNEIIIGNVLSHNFNLFENDPLELIITDEIKNTYIARK---------- 173
gi 15594425  65 TMLIILASIFIVIAVNTYYLQKRIIINKNKAILILLAMGLRIKKIKQIFFIHSIIICTVGGLLGLTLGISISLNINEILK 144
gi 15594427 266 LLIFIMALIIIFASINISSSLSMLIFENKKKIAILKSIGMNNLNIKIIFLLISLTLSTIFCGIGIIIGNYLTLKISYLIN 345
gi 15830548 299 IYFFIKLIVALIVIFMIGNSMAMNIVERTREITTLRAIGLKPLHVTRLFLTEGIFIGVIGAVGSLLVGGVLAWIINLYGI 378
gi 19703916 255 IMLVVFSLIAIVAGFLIWITLNTLVREKTKDIGIMRAMGFSKKNIMLIFLIQGIILGIIGIILGIIVSLILLYYIKNYAV 334
gi 15639568 269 VMILLVILIFMVVTVNIYHSMRRSIRTRKEEIAMLVSLGAPVSHVQILFIGNGIMIGFLGSLLGVLLGLLITIHVNEIIA 348
gi 15601609 283 LFGVMGTVMAMVVFVALFNTLTMSVSERTREIGTLSALGAYPSDILAGFVREATLLALCGSLLGTLLTGITIVAVRVADI 362
gi 15801042 299 IYFFIKLIVALIVIFMIGNSMAMNIVERTREITTLRAIGLKPLHVTRLFLTEGIFIGVIGAVGSLLVGGVLAWIINLYGI 378
gi 15605828 282 ITRSVVFSILLVSGFGIFNIIMMTVMEKRREIAILKAMGYEKRDLILIFTLQGLIIGLLGGILGNILAYGMLEWLETLRI 361
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15639570 409 FAEQMLnswrtaIHAIGqlflrtsahvpvtpihlldpahyLERIPIVLSVHALCGVAGGTLCLSLAVCIIPALRAGRVRP 488
gi 15594424     --------------------------------------------------------------------------------
gi 15594425 145 IIDNLV------NTLINflnqilalk-----idgikiqivKNTITPKLFLSDLTFTFCFACFSTMYSSMKATKKIGSQKN 213
gi 15594427 346 FIDNILnf---fLKIFGeensei-----------lnseyyVSEFQIHLSLSFSLTLLGLYMLINILTTLIPLNIVSNLKE 411
gi 15830548 379 AMPPSP------GQTIG-----------------------YTAFIKTSNPELIWVTVVLPILTATGASVLPALRASRLNI 429
gi 19703916 335 DLVSNI------YY--------------------------LKDIPIEISLKEIAIIVGANFIVILISSIFPAYRAARLEN 382
gi 15639568 349 CIETAV------NSAFFlfslfsgtktpsfsvfgtqyfynVERIPVQIFFQEVLFVFLFGTGSASVATYLATRKILLLKP 422
gi 15601609 363 QMPPPP------GRTEG------------------------YPLDLYFSFTLVGFCTLGTVLICVLAAWFSARKGVNKPI 412
gi 15801042 379 AMPPSP------GQTIG-----------------------YTAFIKTSNPELIWVTVVLPILTATGASVLPALRASRLNI 429
gi 15605828 362 EVEGII------R---------------------------AKGFILDRSLWYHFFGFVFALLTSYLASFYPAYRASKFHP 408

                ....*..
gi 15639570 489 LDLMRKV 495
gi 15594424     -------
gi 15594425 214 IETINGQ 220
gi 15594427 412 KEILR-- 416
gi 15830548 430 SDAFKFS 436
gi 19703916 383 VEALRYE 389
gi 15639568 423 AEVLRDE 429
gi 15601609 413 TEALAYV 419
gi 15801042 430 SDAFKFS 436
gi 15605828 409 VEVFRSG 415
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap