Conserved Protein Domain Family
AguA2

?
COG3661: AguA2 (this model, PSSM-Id:226187 is obsolete and has been replaced by 442878)
Alpha-glucuronidase [Carbohydrate transport and metabolism]
Statistics
?
PSSM-Id: 226187
Aligned: 3 rows
Threshold Bit Score: 1169.67
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16127043  16 AARAEDGYDLWLRYKPVAESARV-AYAARAAAIAPVAETPTLTVARAELERGLTGLVG-QPASAAAGARDGVILLASGAT 93  Caulobacter crescen...
15613624   1 MNRGETGYETWLRYEEITDSALHtQYRAYFQTIEIKGNSPIIESAKEELMQGLRSLLGvTPKCLSATGEQASCLIGTIAD 80  Bacillus halodurans
3912995    1 MDYR----MCWLEYRGLPADVAG-KLKDWFSSVSILE--PGSSVLKDEIRRFSERSIGiTPRFYSRPLKKEKYIM--VGR 71  Thermotoga maritima
16127043  94 PAITGLGLPLKtLGEEGYLIRTVTVGGKATTVIAANRDIGVLYGVFRYLSLIQTGQSVDKLDIVSVPKVKLRMLNHWDNL 173 Caulobacter crescen...
15613624  81 VAEVSQAIKER-LREEGYAIYSEKGR----LVLVGKTETGVLYGTFHLLRLLQMRDHLHDLRIVENPRNQLRMINEWDNM 155 Bacillus halodurans
3912995   72 LESLPIKLDVN-LGEEGFMLRTIEWNGSKILLVTGETKKALVYGIFDLMKRIRLGEDIEKMNVLAKPKAKFRMLNHWDNL 150 Thermotoga maritima
16127043 174 DRHVERGYSGQSIFDWWRLPGHVDPRMVDYARANASLGINGTVLNNVNAK-ADS--LTAPFIAKAAALADTFRPYGIKVY 250 Caulobacter crescen...
15613624 156 DGSIERGYAGGSIFFEHNKVTNNLQRIKDYARILSSIGINAIAFNNVNVHeEETklITRKFLPDVAKVANIFRQYGIKTF 235 Bacillus halodurans
3912995  151 DGTIERGYAGNSIFFKDNRIIIN-QRTKDYARLLASIGINGVVINNVNVKkREVylIDSIYLKKLKKLADIFREYGIKIY 229 Thermotoga maritima
16127043 251 LTARFSSPMEIGGLKTADPLDPAVRAFWKAKADEIYKTIPDFGGFLVKANSEGQPGPQDYGRTHVDGANMLADAVGPHGG 330 Caulobacter crescen...
15613624 236 LSINYASPIQLGKLETADPLDEKVRAWWKETVADIYRYIPDFGGFLVKADSEHRPGPFTYGRNHAEGANMLAEALAPFGG 315 Bacillus halodurans
3912995  230 LSINFASPVYLGGLDTADPLDERVARWWREKARGIYDYIPDFGGFLVKADSEFNPGPHMFGRTHAEGANMLARALAPFGG 309 Thermotoga maritima
16127043 331 VVFWRAFVYSHEQ-----PEDRAKQGYNEFKPFDGQFRDNVVIQVKNGAIDFQPREPFHPLFGAMPKTNLGMEFQITKEY 405 Caulobacter crescen...
15613624 316 IVLWRCFVYNCLQdwrdrKTDRARAAYDHFKPLDGLFHDNVVLQIKNGPMDFQVREPVSPLFGAMPKTNQMLEFQITQEY 395 Bacillus halodurans
3912995  310 VVIWRAFVYNCLQdwrdyKTDRAKAAYDNFKPLDGQFDDNVIIQIKYGPMDFQVREPVNPLFGGMEKTNQILELQITQEY 389 Thermotoga maritima
16127043 406 LGFSTHLVYLGPMFEETLASDTMAKGKGSTVAKVIDGSLDGRKLTAMAGVANIGSDRNWSGSQFDQANWYVFGRLAWDPE 485 Caulobacter crescen...
15613624 396 TGQQKHLCYLVPQWKEILDFDTFANGKESPVKSIVDGSQYDYKVSGITAVSNVGNDENWTGHLLAQANLYGYGRLTWNPN 475 Bacillus halodurans
3912995  390 TGQQIHLCFLGTLWKEILEFDTFAKGEGSYVKRIVDGTLFDRENNGFAGVSNVGDSVNWTGHDLAQANLYAFGRLAWNPD 469 Thermotoga maritima
16127043 486 AGTQAIAQDWTRMTFGADPRLVTPVVSMMMGSREAAVDYMTPLGLHHQMGEGHHYGPGpwVSGGPRADWTsvYYAKASET 565 Caulobacter crescen...
15613624 476 LSTEEVTTEWTRATFGDNEEVIQTIHEMLLQSWLIYESYTAPLGVGWMVEPGHHYGPN--VDGYEYSVWG--TYHYADCH 551 Bacillus halodurans
3912995  470 EEIERIVEEWIKLTFGDDEKVLENVSYMLMKSHRTYEKYTTPFGLGWMVNPGHHYGPN--PEGYEYSKWG--TYHRANWE 545 Thermotoga maritima
16127043 566 GIGFDRTAT-GSNATAQYAPAVGACYADLKCVDEKDLLWFHHLPWDYRLKSGDTLWDGMVKRYGRGVSYVDGMNRTWAGL 644 Caulobacter crescen...
15613624 552 GIGVDRTVAtGTGYTAQYFAENYELYEHLETCPDSLLLFFHHVPYTHKLKSGVTVIQHIYDTHFSGAEQAEQLLESWRSL 631 Bacillus halodurans
3912995  546 AIGVDRTSR-GTGYTLQYHSPWKEIYDDINTCPEDLLLFFHRVRYDHRLKSGKTLLQTMYDLHFEGVEEVEEFIKKWEEL 624 Thermotoga maritima
16127043 645 APYVDARRHREVSDYLKIQRAEAQWWRDASIAWFQtfaKRplpAGEPApnhtlEYYKALgFPF 707 Caulobacter crescentus CB15
15613624 632 EGKVDSERFQQVLERLEHQAEHAKEWRDVINTYFY---RK---SGIPD-----EKKRTI-YPI 682 Bacillus halodurans
3912995  625 KDRVSPDIFERVKERLHMQLEHAKEWRDVINTYFY---RR---TGIPD-----EKGRKI-YP- 674 Thermotoga maritima
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap