Conserved Protein Domain Family
COG3589

?
COG3589: COG3589 (this model, PSSM-Id:226117 is obsolete and has been replaced by 442808)
Uncharacterized protein [Function unknown]
Statistics
?
PSSM-Id: 226117
Aligned: 8 rows
Threshold Bit Score: 424.492
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11497016   1 MKEIGISIYP-NVSPKNKIIKYLEKSAHFGFTQVFTSLLYINGN------EFDIFKELLSIANKNGMKPIIDVSPEIFKE 73  Lyme disease spiroc...
15616135   1 -MERGFSLFLgNSGYRTDQTQYIRRMSEARFTFVFTSLHIPEEDaa---lYVERLDQLVREAHRYGLRVIVDVAPS---- 72  Bacillus halodurans
15673111   1 --MYGYSIFM-NRDLNEKDYLYIDKMTNHGFKGIFTSMHIPEDEas---lYKKRLIDLGTAAKKNHLKLMVDISGQALEK 74  Lactococcus lactis ...
15672155   1 MGKLGVSIYP-ERSNFEADKAYLDLAHQYGFKRVFTSLLEIDGDke---gVLAAFKKVVDYANQLGMEVMVDINPGLFTQ 76  Lactococcus lactis ...
15925894   1 --MTGFSVYL--GQP--LDEAYIKRMIKQGYQMIFTSVQIPEEDde---tKYHYFTKLLNLLKYEQVTYLIDANPSILTP 71  Staphylococcus aure...
15675269   1 MVDLGFSLYP-ERYDVTKSKAYIDLCHSYGAKRLFMSLLQLAPAdh---qMFHCYAELIAYANQLGIRVIADVSPSFISQ 76  Streptococcus pyoge...
15898114   3 KRRIGFSIFPgWKEIKDEQISLLKNARDLGFSEIFMGIGPGTHWrtpvneALSVAKEILKEANKLDYYAFVDINPQILKE 82  Sulfolobus solfatar...
16800896   1 MRKLGISVFP-QHVALEESLEYIETAAKYGFSRIFTCLISANDEa-----EFAKLETICKRAKELGFDVIADVDPTVFES 74  Listeria innocua
11497016  74 LGIDLSnlrncpKLDYFKKLGAWAIRLDNTFTGIEESLMTFNDsdLKIQLNISNINK-HIDTIMYFKPNIKNLLGCHNFY 152 Lyme disease spiroc...
15616135  73 ---SLP------YVASLDES-VDGLRLDYGFSADAITELAKT---YQIAFNASTLTEtFLHELVNQGLSLKNVEAWHNYY 139 Bacillus halodurans
15673111  75 AGCSID------RVEELQELGVTGLRMDYHISNETIAQVSQK---MTVSLNASTIRQeDIDELKEYKANFNQLEAWHNYY 145 Lactococcus lactis ...
15672155  77 LNISYD------DLSFFHEMGADGVRLDIGFTGAEEARMTRNPygIKIEINMSQGTT-YVDSIMDYSPDTEKLLGSHNFY 149 Lactococcus lactis ...
15925894  72 ---SFY-------EHLRQYDAQFMIRIDHSTSIEAIEAIMAQG--LKCCLNASIISReLLTSLHQQLNDFTLLSFCHNYY 139 Staphylococcus aure...
15675269  77 AGWSDQ------LIERAHAFGLAGLRLDEALPLAEIVTLTRNPfgLKIELNMSTDKQ-LLMSLLATDAERSNIIGCHNFY 149 Streptococcus pyoge...
15898114  83 LNASPR------NLSMFMEIGFKGVRADYGFSKEEIVEMSKQ---MTVELNPFEISE-EEVDFIARNANLERIKACHNYY 152 Sulfolobus solfatar...
16800896  75 LNITYK------ELDRFKELGLAGLRLDLGFSGSEEAAMSFDDtdLKIELNISNGTR-YVENILSYQANVGNIIGCHNFY 147 Listeria innocua
11497016 153 PHKYTGLSRNFFKETTKIFKHYSIPTAAFISSNNAEeCARGKEKEGVPTLESHRSKDIETQAKDLFKEG-IDTVLISNCF 231 Lyme disease spiroc...
15616135 140 PRPETGLSLEWIKRRNQWLHTQGLKTVAFVSGDGQ---RRGPLYRGLPTAEAHREVSPYGAARDLHDRLhTDAIVIGDQD 216 Bacillus halodurans
15673111 146 PRPETGLSRESFLRKNEFLKRNSFKVMAFIPGDDS---LRHPLYEGLPTLEAHRYQHPLSSLLDMESLN-IDHIYVGDGG 221 Lactococcus lactis ...
15672155 150 PHRYTGLEFNHYLKCTEKFKGYNLNTMAFVNSQAATfGPWPTQD-GLCTLEDHRSLEIATQVKHYKLLGgIDDVTIANAY 228 Lactococcus lactis ...
15925894 140 PRPDTGLSVDLVNKKNELIYQFNPKAQIYGFIVGS--GLRGPLHKGLPTIEATRHSHPVVAAKLLQETG-VSEVLVGDSL 216 Staphylococcus aure...
15675269 150 PHEFTGLSWQHFKDMSRFYHEHDIETAAFITAQSASeGPWLLAE-GLPTVEDHRHLPIGLQVELMKAIGtIDNILISNQF 228 Streptococcus pyoge...
15898114 153 PVLYSGISKEIFIEKNRIFKERGIEIGAFISNPKFN---------LRTTLEVLRYVEPFDSANYLFKFV--DRVLIGDPI 221 Sulfolobus solfatar...
16800896 148 PRKYTGLSREHFLRTSKQFKDLNLRTAAFVSSNSGEfGPWFVVDGGLPTMEEHRGVDITVQAKDLWNTGlIDDVIVGNMF 227 Listeria innocua
11497016 232 PSETELKKVS-KVNRNILELKADLNPDANSVEKEIILENLHFNRGDINSYRIRSTMPRVYYNNKKFPVHS-P----NEIK 305 Lyme disease spiroc...
15616135 217 LSP--YSLMT--FRENEARLRVSVREDIQEAELALLQLP-HRQRFDPARDVIRSETSRPYARKGEFAIRAkEtqtpSSRL 291 Bacillus halodurans
15673111 222 LK----ARTAwQINQYLQEGELVLQATQATNDFAKVLGE-HENRQDDARDVIRSAQARFNEISEINPENT------IERK 290 Lactococcus lactis ...
15672155 229 ASEEELKAMSqAFNASMPEIKVVPRETISENERKCLFEATHSYRGDKSAYMLRSTMTRITYKDLEFPAHD-T----DKIQ 303 Lactococcus lactis ...
15925894 217 IE---MRQAKqLIDFCKHRHFTLCIEEVFDTTVTYLFDMCHKVRPDNPENVIRSETSRQICPHSIQPQFT------TQRR 287 Staphylococcus aure...
15675269 229 ISEEELAACTqALARPVTTIKVRPIIDLTEVEEQIIGYP-HCYRGDVSDYVIRSTMPRLVYAQESIAPRDqS----KEVK 303 Streptococcus pyoge...
15898114 222 PDYESLRQVSeVFKSDITKIRIKVYDESVGKRLDKKFAVENYREFAIVCYTRDNIYEGETCYTKLFKNAVa-----VRGR 296 Sulfolobus solfatar...
16800896 228 ASEDELRALS-ELNRNELQLAVEFLDGATDVEKEIVLTQKHFNRGDASEYVLRSTMTRVNFKQFDFPAHD-T----NTIA 301 Listeria innocua
11497016 306 KGDILIDSSEYLGYTGELQIALKDTPNNGLVNVVGKIINDEIYLLEKIEPWEKFKIIENK 365 Lyme disease spirochete
15616135 292 KGTVTIDNETYGRYEGELQIMKKELPFDEKVNVVANVREEDMILLDILRPGEPFRLVTDE 351 Bacillus halodurans
15673111 291 KGSITIDNCEYGRYMGEIQITKRNLPADKKVNVVGNIIKEDLELISFIGPGQKFKIEKEK 350 Lactococcus lactis subsp. lactis
15672155 304 RGDVIIDNEGYGQYKGETQIALREMENDGRVNVVGRIADDELFLLDFLKPWSSFKLIESK 363 Lactococcus lactis subsp. lactis
15925894 288 IGSVTVDNLNNGRYQGEMQIVRQTLSAHDNVNVVAQIIKEDLPLLSCIEPNDTFDFQKTR 347 Staphylococcus aureus subsp. aureus N315
15675269 304 RGSIIIDNDRYHRYKGELQIALKNFTVSSKANVVAEVREDYLSLLDDLRPWQEFCLEIAP 363 Streptococcus pyogenes M1 GAS
15898114 297 EVWIFTRDLGIGPYRLVGEIDDINMEIVKMSSEIMLISK--------------------- 335 Sulfolobus solfataricus
16800896 302 KGDVTIDNDGYERYKGEMQVALQEMENSGNTNIVARIVPEERYLLDTILPWQHFRLVEKK 361 Listeria innocua
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap