Conserved Protein Domain Family
HmgA

?
COG3508: HmgA 
Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport and catabolism]
Statistics
?
PSSM-Id: 226039
Aligned: 7 rows
Threshold Bit Score: 508.6
Threshold Setting Gi: 13431998
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
21263641   3 NTGRlgfvklgagikedrmafsYMPGFGNDFETETLPGSLPQGRNSPQRPAYGLYAEQLSGSPFTAPRGTNERSWLYRIR 82  Mesorhizobium loti
21263642   1 MDLR------------------YQTGFGSYFETEAHPGALPVGRNSPQKVPFGLYAEQLSGSAFTAPRHENRRTWLYRLR 62  Caulobacter crescentus
12644655   3 LDSTal---------------aYQSGFGNEFSSEALPGALPVGQNSPQKAPYGLYAELLSGTAFTMARSEARRTWLYRIT 67  Pseudomonas aeruginosa
21263635   3 MLAPaaknaftp---aspdrpaYQSGFGNEFATEALPGALPHGQNSPQQAPYGLYAEQLSGTAFTAPRAHNRRAWLYRIR 79  Ralstonia solanacearum
7387756    3 EKAEkqrrags----gqqraagYMPGFGNDFETESLPGALPQGQNSPQKCNYGLYAEQLSGSPFTAPRGTNERSWLYRIR 78  Sinorhizobium meliloti
15898360   1 ----------------------------MVFYHRQGELPKKRHTVFMKDGKLMR--EEVFG--------LNGFNGRYSLL 42  Sulfolobus solfatar...
13431998   1 ------------------------MHKWITFPHREGTCSRQAHADFPEQAIY----EREAG-----------RSGFFGPA 41  Vibrio cholerae
21263642   1 MDLR------------------YQTGFGSYFETEAHPGALPVGRNSPQKVPFGLYAEQLSGSAFTAPRHENRRTWLYRLR 62  Caulobacter crescentus
12644655   3 LDSTal---------------aYQSGFGNEFSSEALPGALPVGQNSPQKAPYGLYAELLSGTAFTMARSEARRTWLYRIT 67  Pseudomonas aeruginosa
21263635   3 MLAPaaknaftp---aspdrpaYQSGFGNEFATEALPGALPHGQNSPQQAPYGLYAEQLSGTAFTAPRAHNRRAWLYRIR 79  Ralstonia solanacearum
7387756    3 EKAEkqrrags----gqqraagYMPGFGNDFETESLPGALPQGQNSPQKCNYGLYAEQLSGSPFTAPRGTNERSWLYRIR 78  Sinorhizobium meliloti
15898360   1 ----------------------------MVFYHRQGELPKKRHTVFMKDGKLMR--EEVFG--------LNGFNGRYSLL 42  Sulfolobus solfatar...
13431998   1 ------------------------MHKWITFPHREGTCSRQAHADFPEQAIY----EREAG-----------RSGFFGPA 41  Vibrio cholerae
21263641  83 PSVKHTGrFKAASYPLWKTAPNVGDheLALGQYRWNPVPMPKEPTDFIQGMRSITTAGDVLGQTGMAAHVYVANRSMVDD 162 Mesorhizobium loti
21263642  63 PSAGHEA-YQPYAQDKLVSAFPGP---ATPNRLRWSPLEIPAAPTDFVDGLVSLAGNADAATLGGIAAHVYLVNVSMKNR 138 Caulobacter crescentus
12644655  68 PSAKHPP-FRRLERQIAGAELDAP----TPNRLRWDPLALPEQPTDFLDGLLRMAANAPGDKPAGVSIYQYLANRSME-R 141 Pseudomonas aeruginosa
21263635  80 PAAVHLP-FEPIAQDRFHSDFHAVP--ASPNQLRWDPLPAPAAGTDFIDGIVTFAGNGGPDAQTGCGIHLYAANASMTGR 156 Ralstonia solanacearum
7387756   79 PSVRHTGrFRRVDYPHWKTAPHVGEhsLALGQLRWSPLPAPSEALDFLQGIRTMTTAGDALTQAGMAAHAYAFNADMVDD 158 Sinorhizobium meliloti
15898360  43 YHLNPPT--RIMKLGEWKSNTIGEWkdAEYRHHKLSTSKLRKSSDVFLDRIALIFN-------DNLIISFSKVDEGDTKL 113 Sulfolobus solfatar...
13431998  42 AHFHHQH--APTGWSEWEGELRPR-------AFNFNHVEGVNALSPWQVPLLLHN--------HEVKVRVWKLEQAMP-A 103 Vibrio cholerae
21263642  63 PSAGHEA-YQPYAQDKLVSAFPGP---ATPNRLRWSPLEIPAAPTDFVDGLVSLAGNADAATLGGIAAHVYLVNVSMKNR 138 Caulobacter crescentus
12644655  68 PSAKHPP-FRRLERQIAGAELDAP----TPNRLRWDPLALPEQPTDFLDGLLRMAANAPGDKPAGVSIYQYLANRSME-R 141 Pseudomonas aeruginosa
21263635  80 PAAVHLP-FEPIAQDRFHSDFHAVP--ASPNQLRWDPLPAPAAGTDFIDGIVTFAGNGGPDAQTGCGIHLYAANASMTGR 156 Ralstonia solanacearum
7387756   79 PSVRHTGrFRRVDYPHWKTAPHVGEhsLALGQLRWSPLPAPSEALDFLQGIRTMTTAGDALTQAGMAAHAYAFNADMVDD 158 Sinorhizobium meliloti
15898360  43 YHLNPPT--RIMKLGEWKSNTIGEWkdAEYRHHKLSTSKLRKSSDVFLDRIALIFN-------DNLIISFSKVDEGDTKL 113 Sulfolobus solfatar...
13431998  42 AHFHHQH--APTGWSEWEGELRPR-------AFNFNHVEGVNALSPWQVPLLLHN--------HEVKVRVWKLEQAMP-A 103 Vibrio cholerae
21263641 163 HFFNADGELLVVPQVGALRFVTEMGVIELRPGEIAVLPRGLVFKAELVDKD--VRGYVCENYGAKLTLPDRGPIGANCLA 240 Mesorhizobium loti
21263642 139 VFYNADGEMLIVPQMGELTLVTEMGVLKAGPGHIAVIPRGVRFRVEV-EGP--ARGYVCENYGAAFRLPELGPIGANGLA 215 Caulobacter crescentus
12644655 142 CFYDADGELLLVPQLGRLRLCTELGALQVEPLEIAVIPRGMKFRVELLDGE--ARGYIAENHGAPLRLPDLGPIGSNGLA 219 Pseudomonas aeruginosa
21263635 157 FFYNADGELLIVPQQGRLRLLTELGVLDVEPLEIAVIPRGVRFRVELPDGE--ARGYLCENFGAIFRLPDLGVIGSNGLA 234 Ralstonia solanacearum
7387756  159 YFFNADGELLIVPETGAIQVFTELGRMDVEPSEICLIPRGMMFKVTRLGEEkvWRGYICENYGAKFTLPDRGPIGANCLA 238 Sinorhizobium meliloti
15898360 114 FYRNADFDEIYYVHSGEILFKSVFGEIEVKEGDYLVIPRGTTYTLSFKKNAelFIIEGKQIEVPKDYRNEYGQLVEGSFY 193 Sulfolobus solfatar...
13431998 104 LARNADGDELLFIHQGKADLYCDYGHMVVSEGDYALIPRSTNWRLEPIEPL---FILMIENTDAAYALPEKGLVGNHAVF 180 Vibrio cholerae
21263642 139 VFYNADGEMLIVPQMGELTLVTEMGVLKAGPGHIAVIPRGVRFRVEV-EGP--ARGYVCENYGAAFRLPELGPIGANGLA 215 Caulobacter crescentus
12644655 142 CFYDADGELLLVPQLGRLRLCTELGALQVEPLEIAVIPRGMKFRVELLDGE--ARGYIAENHGAPLRLPDLGPIGSNGLA 219 Pseudomonas aeruginosa
21263635 157 FFYNADGELLIVPQQGRLRLLTELGVLDVEPLEIAVIPRGVRFRVELPDGE--ARGYLCENFGAIFRLPDLGVIGSNGLA 234 Ralstonia solanacearum
7387756  159 YFFNADGELLIVPETGAIQVFTELGRMDVEPSEICLIPRGMMFKVTRLGEEkvWRGYICENYGAKFTLPDRGPIGANCLA 238 Sinorhizobium meliloti
15898360 114 FYRNADFDEIYYVHSGEILFKSVFGEIEVKEGDYLVIPRGTTYTLSFKKNAelFIIEGKQIEVPKDYRNEYGQLVEGSFY 193 Sulfolobus solfatar...
13431998 104 LARNADGDELLFIHQGKADLYCDYGHMVVSEGDYALIPRSTNWRLEPIEPL---FILMIENTDAAYALPEKGLVGNHAVF 180 Vibrio cholerae
21263641 241 NPRDFKTPCA----WFEEKETPCRLIVKWCGNFHVTEIGHSPLDVVAWHGNYAPYKYDLATFSPVGAILFDHPDPSIFTV 316 Mesorhizobium loti
21263642 216 NPRDFEAPVA----AFEDIDTPTQVIQKFQGALWAATWDHSPLDVVAWHGNLTPYRYDLSRFNTINTVSYDHPDPSIFTV 291 Caulobacter crescentus
12644655 220 NPRDFLTPVA----RYEDSRQPLQLVQKYLGELWACELDHSPLDVVAWHGNNVPYKYDLRRFNTIGTVSFDHPDPSIFTV 295 Pseudomonas aeruginosa
21263635 235 NPRDFLTPHA----WYEDREGDFELVAKFHGNLWRARIGHSPLDVVAWHGNYAPYKYDLRLFNTIGSISYDHPDPSIFLV 310 Ralstonia solanacearum
7387756  239 NPRDFKTPVA----AYEDKETPCRVQVKWCGSFHMVEIGHSPLDVVAWHGNYAPYKYDLKTFSPVGAILFDHPDPSIFTV 314 Sinorhizobium meliloti
15898360 194 YNRDLKLPVL----RTYDENGNYKLVIKTVNGFQLVELDTHPFDVVGWDGYLYPFALSVYDLEPI-TGKLHQP-PTAYTT 267 Sulfolobus solfatar...
13431998 181 DPAVLDVPSIndqfRAQYSEQQTQVQVKRHGQLSTITFPFNPLDAVGWHGDLSVVRLNWRDIRPLMSHRYHLP-PSAHTT 259 Vibrio cholerae
21263642 216 NPRDFEAPVA----AFEDIDTPTQVIQKFQGALWAATWDHSPLDVVAWHGNLTPYRYDLSRFNTINTVSYDHPDPSIFTV 291 Caulobacter crescentus
12644655 220 NPRDFLTPVA----RYEDSRQPLQLVQKYLGELWACELDHSPLDVVAWHGNNVPYKYDLRRFNTIGTVSFDHPDPSIFTV 295 Pseudomonas aeruginosa
21263635 235 NPRDFLTPHA----WYEDREGDFELVAKFHGNLWRARIGHSPLDVVAWHGNYAPYKYDLRLFNTIGSISYDHPDPSIFLV 310 Ralstonia solanacearum
7387756  239 NPRDFKTPVA----AYEDKETPCRVQVKWCGSFHMVEIGHSPLDVVAWHGNYAPYKYDLKTFSPVGAILFDHPDPSIFTV 314 Sinorhizobium meliloti
15898360 194 YNRDLKLPVL----RTYDENGNYKLVIKTVNGFQLVELDTHPFDVVGWDGYLYPFALSVYDLEPI-TGKLHQP-PTAYTT 267 Sulfolobus solfatar...
13431998 181 DPAVLDVPSIndqfRAQYSEQQTQVQVKRHGQLSTITFPFNPLDAVGWHGDLSVVRLNWRDIRPLMSHRYHLP-PSAHTT 259 Vibrio cholerae
21263641 317 LTAPSGEEGTANIDFVIFPPRWLVAEDTFRPPWYHRN-IMSEFMGLIHGQYDAKEEGFVPGGISLHNLMLAHGPDAPGFE 395 Mesorhizobium loti
21263642 292 LTSPSDTPGTANCDFVIFPPRWMVAEDTFRPPWFHRN-VMSEFMGLIHGAYDAKAGGFVPGGASLHNCMSDHGPDVASHK 370 Caulobacter crescentus
12644655 296 LTSPTSVPGLANIDFVIFPPRWMVAENTFRPPWFHRN-LMNEFMGLIQGAYDAKAGGFVPGGASLHSCMSAHGPDAESCD 374 Pseudomonas aeruginosa
21263635 311 LQSVSDTPGVDAIDFVIFPPRWLAMEHSFRPPWFHRN-IASEFMGLIQGVYDAKAEGFVPGGASLHNCMTGHGPDAETFE 389 Ralstonia solanacearum
7387756  315 LTAPSGEEGTANVDFVIFPPRWLVAEHTFRPPWYHRN-IMSEFMGLIYGRYDAKEEGFVPGGMSLHNMMLAHGPDFSGFE 393 Sinorhizobium meliloti
15898360 268 FAA--D--DFVVCTFVPRL--FDYHPQSVPISYYHNNiDAEEIIFYSSGQFMSRR-GINKGDITLHRGGHIHGPQPSAVE 340 Sulfolobus solfatar...
13431998 260 FVG----QGFVVCTFVPRP--IESDPGALKVPFYHNNdDYDEVLFYHAGDFFSRD-NIEAGMVTFHPAGFTHGPHPKAFQ 332 Vibrio cholerae
21263642 292 LTSPSDTPGTANCDFVIFPPRWMVAEDTFRPPWFHRN-VMSEFMGLIHGAYDAKAGGFVPGGASLHNCMSDHGPDVASHK 370 Caulobacter crescentus
12644655 296 LTSPTSVPGLANIDFVIFPPRWMVAENTFRPPWFHRN-LMNEFMGLIQGAYDAKAGGFVPGGASLHSCMSAHGPDAESCD 374 Pseudomonas aeruginosa
21263635 311 LQSVSDTPGVDAIDFVIFPPRWLAMEHSFRPPWFHRN-IASEFMGLIQGVYDAKAEGFVPGGASLHNCMTGHGPDAETFE 389 Ralstonia solanacearum
7387756  315 LTAPSGEEGTANVDFVIFPPRWLVAEHTFRPPWYHRN-IMSEFMGLIYGRYDAKEEGFVPGGMSLHNMMLAHGPDFSGFE 393 Sinorhizobium meliloti
15898360 268 FAA--D--DFVVCTFVPRL--FDYHPQSVPISYYHNNiDAEEIIFYSSGQFMSRR-GINKGDITLHRGGHIHGPQPSAVE 340 Sulfolobus solfatar...
13431998 260 FVG----QGFVVCTFVPRP--IESDPGALKVPFYHNNdDYDEVLFYHAGDFFSRD-NIEAGMVTFHPAGFTHGPHPKAFQ 332 Vibrio cholerae
21263641 396 KASRAD-LKPVKLDNTMAFMFETRFPQMLTRYGAELETRQDNYIDCWADLkkrFNGTPE 453 Mesorhizobium loti
21263642 371 KATEVV-LAPHKIDGTMAFMFESRWVFRPTHLALESAALQSDYDACWTG----FPKARL 424 Caulobacter crescentus
12644655 375 KAIAAD-LKPHRIDQTMAFMFETSQVLRPSRAALETPALQNDYDACWASLvstFNPQRR 432 Pseudomonas aeruginosa
21263635 390 KASHADtTQPHKVEATMAFMFETRGVIRPTRFAAESAQLQARYFECWQGLkkhFDPAKR 448 Ralstonia solanacearum
7387756  394 KASNGE-LKPVKLDNTMAFMFETRFPQQLTTFAAELDTLQDDYMDCWSGLerkFDGTPG 451 Sinorhizobium meliloti
15898360 341 ASLNKR----GTYNDEVAIMVETQKRVKVSIYAKEIDDPT--YPLSWYTS--------- 384 Sulfolobus solfataricus
13431998 333 AGLEYR----KKFTDEVAVMIDTRHALQFSDAAQQVENRQ--YVYSWQS------KVE- 378 Vibrio cholerae
21263642 371 KATEVV-LAPHKIDGTMAFMFESRWVFRPTHLALESAALQSDYDACWTG----FPKARL 424 Caulobacter crescentus
12644655 375 KAIAAD-LKPHRIDQTMAFMFETSQVLRPSRAALETPALQNDYDACWASLvstFNPQRR 432 Pseudomonas aeruginosa
21263635 390 KASHADtTQPHKVEATMAFMFETRGVIRPTRFAAESAQLQARYFECWQGLkkhFDPAKR 448 Ralstonia solanacearum
7387756  394 KASNGE-LKPVKLDNTMAFMFETRFPQQLTTFAAELDTLQDDYMDCWSGLerkFDGTPG 451 Sinorhizobium meliloti
15898360 341 ASLNKR----GTYNDEVAIMVETQKRVKVSIYAKEIDDPT--YPLSWYTS--------- 384 Sulfolobus solfataricus
13431998 333 AGLEYR----KKFTDEVAVMIDTRHALQFSDAAQQVENRQ--YVYSWQS------KVE- 378 Vibrio cholerae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap