Conserved Protein Domain Family
COG3459

?
COG3459: COG3459 (this model, PSSM-Id:225990 is obsolete and has been replaced by 442682)
Cellobiose phosphorylase [Carbohydrate transport and metabolism]
Statistics
?
PSSM-Id: 225990
Aligned: 9 rows
Threshold Bit Score: 1076.66
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15893898 1787 QYETSRINFIGRGRDVHNPEALNsp--lKNTIGDVLDPVMSLRRRIKLQ-PGKTINISYITAISSS-REEVLEIAKKYSS 1862 Clostridium aceto...
15889981 1717 EFETDRAKFIGRGRSLREAAAFDagatlSSSDGFTLDPILSLRRTVRVP-AGKKVSVIFWTIAAPS-REEVDKAIDRYRH 1794 Agrobacterium tum...
17988120 1754 EVETDRRAFIGRGRSLRNAAAFDpgakfTGSQGCVLDPIVSVRTRVRVP-AHKKVSLVFWTFAGGS-RDAVEHAVTMHRH 1831 Brucella melitensis
17380408 1748 QAETDRRRFLGQGRTLAEAAAFDpgatlSGTDGFTLDPIVSLRRVVRVP-AGKKVSVIFWTIAAPD-REGVDRAIDRYRH 1825 Sinorhizobium mel...
15644591      --------------------------------------------------------------------------------      Thermotoga maritima
15640632      --------------------------------------------------------------------------------      Vibrio cholerae
16120936    1 MITKSITNVVHSAQGGVLQFNFMq----gNMLKNMLAGDIMLN-LFDTPrLDMAIANIFLRQLDDSgIVRVTPLLFHNDQ 75   Yersinia pestis
16800906    1 ------MTMLKEIKKADLSAAFYp----SGELAWLKLKDIMLNQVIQNP-LENRLSQIYVRAHVGD-KIEIYPLLSRDAE 68   Listeria innocua
13476875 1762 EAETDRRAFIGRGRSIVDAAAFDpgaklGGHSGFTLDPIASLRRQVRVP-ANKKISLTFWTVVGAN-RTELEEAINRLDH 1839 Mesorhizobium loti
15893898 1863 QSSIR---RAFEITTTEVKMWMKYLN---MMSSEANLYEMMAS----KILYLSENLNMRsdyIKniKKSQPALWgyGISG 1932 Clostridium aceto...
15889981 1795 PDAFA---HELVHAWTRTQVQMRHVG---VTSQQAAAFQHLGR----YLTYPDMHLRADsetLKtgLASQRALWplAISG 1864 Agrobacterium tum...
17988120 1832 PETFA---REYSLSWTSSQVQLYHIG---IKPAEAADYQKVAA----YLLYPERTLRQPpetIAsgLGKQSDLWpmSISG 1901 Brucella melitensis
17380408 1826 PETFN---HELIHAWTRSQVQMRHVG---ITSKEAASFQMLGR----YLVYPDMHLRADaetVKtgLASQSALWplAISG 1895 Sinorhizobium mel...
15644591      --------------------------------------------------------------------------------      Thermotoga maritima
15640632      --------------------------------------------------------------------------------      Vibrio cholerae
16120936   76 LVTYKnaqDEIIWQTTAPDFTAFVTLsfsHEQEETYYYSVRVEnhsaQALRYDLIYGQD---LS--LSDAGATK--TNES 148  Yersinia pestis
16800906   69 VGFNE---NGVEYRGVVGPFRYSVQM---HFHTRGWFYDVTVD----GDLEFDLVYLQD---LG--LAEQAAVR--TNEA 131  Listeria innocua
13476875 1840 QESFA---RQAMLAWTRSQVQTRHMG---LSLTDAANVQKLAR----YLIYPDAFLRLPaesLAsgLGKQSSLWptSISG 1909 Mesorhizobium loti
15893898 1933 DVPIMLLIVRNDGD-IGFVRQMVRAHEyfEIKGLNVDLVILNLMENSYIQAFqdtINSFINQNIVRTKK-DRIGKIFAFN 2010 Clostridium aceto...
15889981 1865 DFPIFSLRINDDMD-MDIAREALSAHEylRSRGVIFDLVIVNERAASYAQDMqhaLDHISETQRRINPAdGGRPHVFSVR 1943 Agrobacterium tum...
17988120 1902 DYPIFALRIDNEAD-LDVLRGVLRAQEywRSKGLIVDVVAVNERAFSYAQDTqraIDWIVEGFRARG---GGQPHIFAVR 1977 Brucella melitensis
17380408 1896 DFPIFCLRINDDGD-LGIAREALRAQEylRARGITADLVVVNERASSYAQDLqhtLDSMCENLRLRGLSdGPRQHIFAVR 1974 Sinorhizobium mel...
15644591      --------------------------------------------------------------------------------      Thermotoga maritima
15640632      --------------------------------------------------------------------------------      Vibrio cholerae
16120936  149 YCSQYLDHKVFSLDkYGYTVSSRQNLP--QSTGNPLLQLGSFSPAVGFSTDG---YQFFAKQYKFSHLPtIVTEPSLENR 223  Yersinia pestis
16800906  132 YMSQYIDYHVTEGA-TGFTVQARQNQP--QNERFPAVQIGALTKIVGYATDG---FDIYGTNYKLTSELaNLKEKSLPSR 205  Listeria innocua
13476875 1910 DFPIFLVRIGDVAD-LEIVAQALRFQEymRTRGMMIDFVVVNEQASSYVQDLqraVETLCENSRLRGKElGPRQHIFAVR 1988 Mesorhizobium loti
15893898 2011 KSLMPIEDMELLIGISKLVID--SDKGLIVSQLKvqg-------------------keyKEIEDIKVHEVHy-------- 2061 Clostridium aceto...
15889981 1944 RDLMDEETWSALLAASRVVLH--VRNGKIVDQINravslfa-----------anrgpdgSSDAAQARLPVPaf------- 2003 Agrobacterium tum...
17988120 1978 RDQMSEESYNTLLASARIVMH--AQNGSLAEQLRrseeitvdlaarsdartatngqasvQGLGAAGLAPVAiergaeerr 2055 Brucella melitensis
17380408 1975 RDLMEPETWSTLISASRAVFH--ARNGTISDQIAratsly-------------skssekKEEGAEMLLPVIrea-----d 2034 Sinorhizobium mel...
15644591      --------------------------------------------------------------------------------      Thermotoga maritima
15640632      --------------------------------------------------------------------------------      Vibrio cholerae
16120936  224 NYQYEMAYVALQLQPVTLSAGdsADSVFYGFYLS--------------------------HQPEANIAQAFd-------- 269  Yersinia pestis
16800906  206 VYQYEFAQIS--LQTELFTNH--GETIFYGYATE-------------------------NQ-PKASGAPFEn-------- 247  Listeria innocua
13476875 1989 RDLMEETTYKTLLAVARVVLH--TRNGTIFDQIEraeaaalq----------ardglpsTGLPAPREIPAAhafa---sq 2053 Mesorhizobium loti
15893898 2062 nIKDYKFK-----INSLRFFNDYGGFDEANNQYVIILNDnKNTPAPWINVVSNEKFGFHVSERGSAYTWCANSRENKITP 2136 Clostridium aceto...
15889981 2004 pVAEPVED-----AGDLDFWNGFGGFAKNGQEYVVRLNGgQSTPHPWINVISNENFGFHISAEGAGFSWSRNSRDYQLTP 2078 Agrobacterium tum...
17988120 2056 pVVKPPVDrprpsGDDLRFWNGYGGFAEDG-SYVVRINGrTSTPHPWINVIANPSFGFHVSAEGSAFTWAGNSRDYQLTP 2134 Brucella melitensis
17380408 2035 aRTAVELD-----GGDLDFWNGFGGFAEDGREYAVRLRGgEATPQPWINVISNEQFGFHVSAEGAAFSWSRNSRDYQLTP 2109 Sinorhizobium mel...
15644591    1 --------------------MRFGYFDDVNREYVITTPQ---TPYPWINYLGTEDFFSIISHMAGGYCFYKDARLRRITR 57   Thermotoga maritima
15640632    1 --------------------MKYGYFDNDNREYVITRPD---VPAPWTNYLGTEKFCTVISHNAGGYSFYHSPEYNRVTK 57   Vibrio cholerae
16120936  270 -VARIRANy---rQPQREPATEQASPTQQG-YDQRPLSG-DKLTAEEIEQLFDGEKQFVEQLDGELLSFFYQEANYVTLA 343  Yersinia pestis
16800906  248 -LAELKSN------ISEQPYQP-STKAILNKHIGTPITG-ETISDSWLQEN-FPDRIQEEQQNGALLSFFTPNYAHVVMR 317  Listeria innocua
13476875 2054 sVADVSAD-----GSGLSQWNGFGGFDGDGRHYVVRLAGrRTTPQPWINVVSNASFGFHTSAEGAAFTWSRNSRDYQLTP 2128 Mesorhizobium loti
15893898 2137 WNNDPVSDVLGEALYIRDEVTGRYWSISPEPVRD---NDDYIIEHG-FGYSSF-SHYKEGIIGKMT--MFVPMYDNVKLI 2209 Clostridium aceto...
15889981 2079 WTNDPVINRPGEAFYVADVETGKLYTPCAALSRDp--EAMFETRHG-LGYSIL-TGVADTLEVELT--QTVDREKPVKFS 2152 Agrobacterium tum...
17988120 2135 WANDPVTNRPGEAIYILDRETGRSFAPTANVLRDe--AVTYEARHG-HGYSAF-SAQHGELALELT--HIVEAEKPVRLS 2208 Brucella melitensis
17380408 2110 WTNDAVVNRPGEAIFVRDMASGAVLTPYAALSRRk--SALFETRHG-LGYSRF-LSTQDELEIEAM--HTVHRTLPAKLV 2183 Sinorhizobium mel...
15644591   58 FRYNNVPTDAGGRYFYIREENGDFWTPTWMPVRKd--LSFFEARHG-LGYTKI-TGERNGLRATIT--YFVPRHFTGEVH 131  Thermotoga maritima
15640632   58 FRPNFTQDRPGHYVYLRDDATGDFWSISWQPVAKsleQAKYEVRHG-LSYSKF-KCEYNGIHATKT--LFVPKGEDAEVW 133  Vibrio cholerae
16120936  344 EKERHLERPTGHIISSGNNIDFTNPIMNSTHYIYg--VFNSHLTLGnTSFNKLlGVNRNMLNQFKSsgQRILVQIGGEYR 421  Yersinia pestis
16800906  318 EKEAELERPHGSILLDKVDVLNPEATLSATTYMYg--AFLSQLVAGnTNMNKWnSHARNPLNILQTsgLRIYIELDSELR 395  Listeria innocua
13476875 2129 WSNDPVSNRPGEGIYIYDQASGRAFSPIAAVVRDp--SMTYEAWHG-QGFSTF-RAKRGPLSMDLT--HVVDPVDPVKIT 2202 Mesorhizobium loti
15893898 2210 IVKLKNNTEVDRNLALAYYARMVLGVVAEHTEQYISTDIDLKNKIIYSRNPYSTSF--GSLNAFLKIYGg--EDESFTGS 2285 Clostridium aceto...
15889981 2153 QVIVRNKGSKSRRLKVYAYVEWVLGNNGQKSAPFILSRHDAGSNAIFASNPYSIDY--SARTSFLTLDS---EASGFTTS 2227 Agrobacterium tum...
17988120 2209 RLTITNKGRSKRKLRVYGYVEWVLGNARARNVPFIVPSQDEELGALFAGNPYHPDK--SGQVAFFAASE---KPQSVTAD 2283 Brucella melitensis
17380408 2184 RLTIRNRSSAARKLRVYGYAEWVLGNNRSRTAPFVLSEWDESAKTLVATNPYSIDY--PGRCAFFASDG---DIAGYTAS 2258 Sinorhizobium mel...
15644591  132 YLVLENKAEKPRKIKLFSFIEFCLWNALDDMTNFQRNYSTGEVEIEGSVIYHKTEY--RERRNHYAFYSvnqPIDGFDTD 209  Thermotoga maritima
15640632  134 DVVIENTSNEVRTISAFNYVEFSFSHIKSDNQNHQMSLYSAGTAFKDGVIEYDLYYntDDFLGFYYLTAt-fDADSYDGQ 212  Vibrio cholerae
16120936  422 ILAMPSAYEVGANFSRW-IYKLAEGMIQVRAFASQ-SEPVIQLDIAVSGHSQPLNVivSHQLIMGNLEE---EATVQVER 496  Yersinia pestis
16800906  396 LLGVPSVWETSTNYSTW-YYQWNGDLITVQTTLTADSKEAFVTVHSEKGHSYKLVL--TNQVTMGTNEY---DTTVKKEI 469  Listeria innocua
13476875 2203 RLRIQNSGSVPARLRVYAYAEWVLGGHRSRTAATIVPSRDGATGALLAQNPYGLDF--SERVAFLAADA---AVHSVTSD 2277 Mesorhizobium loti
15893898 2286 RREF--IGRGNNLHIPQAMKK-ARLSNTAGSGIEPCMAEKVKITLKPNEEKEIVIMLGEETSLAQ-------------IK 2349 Clostridium aceto...
15889981 2228 RREF--IGRFGSAQAPQGIVAgAALSGTTEVDGDPCAALMQEIHLKPGEERHMTFILGDADNAEE-------------AE 2292 Agrobacterium tum...
17988120 2284 RGEF--IGTAGSVDRPEIVLAgKVLSGTVEAGRDPCAALALDIEVGPGEAREIVFLLGNTADQKQ-------------AK 2348 Brucella melitensis
17380408 2259 RREF--LGRAGGILAPQAVISgAELTGSTDVDGDACAALATDITVEAGVERQVTFFLGDADNPDQ-------------VR 2323 Sinorhizobium mel...
15644591  210 RESF--IGLYSGFEAPQAVVE-GKPRNSVASGWAPIASHYLEIELAPSEKKELIFILGYVENPEEekwekpgvinkkrAK 286  Thermotoga maritima
15640632  213 RDQF--LGMYRDEANPIAVAQ-GKCSNSAQTCYNHCGALHKQFVLQPGEKVRFAVILGVGKGNGA--------------- 274  Vibrio cholerae
16120936  497 HGDLlqISRTGDDHGPRFSIAtRGGFTGVERYVDSDSQGVQYLLLQGQIAQQASIAFGGVLNGVD--------------- 561  Yersinia pestis
16800906  470 KDGI--VTYFPAEDSPILETY-PALQFRVDGTYNELTDERYFAKDYVGTAGLDVFVFEPSDKATFhv----------qAK 536  Listeria innocua
13476875 2278 RSEF--LGRHGSSELPQAVLTgAALSGRVEAGDDPCAAIARDVEIPAGGDVTLLWLLGDADTPAQ-------------AS 2342 Mesorhizobium loti
15893898 2350 SVTDRYSSIENSERELTNTKEYWKSILNTVVVN---TPDESMNIIMNGWLMYQLISCRLWSRTAFYQSGG---AYGFRDQ 2423 Clostridium aceto...
15889981 2293 ALVKDVRQADFLSV-LEESKKFWTGFTGQLQVS---TPDAGFNHMVNNWLPYQALACRILARTAFYQSSG---AFGFRDQ 2365 Agrobacterium tum...
17988120 2349 ALIADMRTASFEEK-LVAARHQWESFFNRVQVK---TPDPAFDLMVNGWLPYQAVACRIWARAAFYQASG---AFGFRDQ 2421 Brucella melitensis
17380408 2324 AVLEELRADSFGAA-LEAAKAFWGDFTGVVKVE---TPDRAFNHMINHWLPYQALGCRIMARSAFYQASG---AFGFRDQ 2396 Sinorhizobium mel...
15644591  287 EMIEKFKTGEDVEHALKELREYWDDLLGRIQVE---THDEKLNRMVNIWNQYQCMVTFNISRSASYFESGisrGIGFRDS 363  Thermotoga maritima
15640632  275 KLREKYQDLSKVDSAFAGIKAHWDERCAKFQVK---SPNQGLDTMINAWTLYQAETCVVWSRFASFIEVGgrtGLGYRDT 351  Vibrio cholerae
16120936  562 SRGKWLDFEHERQAYHAQYRALLNDFSVSFSAAp--QQAQKLNHAM-HWFTHNALTHYSSP-HGLEQPAGa--AWGTRDV 635  Yersinia pestis
16800906  537 LSDEFSKPTEDLEANNKVIRASYDELTAQFHLNhqsTTAEKLNLTV-YWYAHQMLVHYASP-HGLEQYSGa--AWGTRDV 612  Listeria innocua
13476875 2343 ALVQTHRGKDFDQR-LADNEREWRGFLDTIQVE---TPDKALDAMVNHWLPYQSLACRIRARSAFYQASG---AFGFRDQ 2415 Mesorhizobium loti
15893898 2424 LQDTMPLTFVR--PDMTRKQILISASRQFVE-GDVQH-----WWHPVVDSG--------------------IRTRFSDDL 2475 Clostridium aceto...
15889981 2366 LQDTLAFLLYQ--PDLARTQILRAAGRQFPE-GDVQH-----WWLPLTGAG--------------------VRTTISDDV 2417 Agrobacterium tum...
17988120 2422 LQDTLSLLLVD--PSLAREQILNAASRQFRE-GDVQH-----WWLPATGAG--------------------VRTLISDDV 2473 Brucella melitensis
17380408 2397 LQDTLAFLIHR--PALARAQILNAAARQFVE-GDVQH-----WWLPGTDAG--------------------VRTMISDDV 2448 Sinorhizobium mel...
15644591  364 NQDILGFVHMI--PEKARQRILDLASIQFED-GSTYH-----QFQPLTKKGnn-----------------eIGGGFNDDP 418  Thermotoga maritima
15640632  352 AQDAISVPHTN--PAMTRKRLVDLLRGQVKA-GYGLHlfdpdWFDPEKADVkpsksptvvptpsdedkihgIKDTCSDDH 428  Vibrio cholerae
16120936  636 SQGPIEFFMAMgrYQQVEAILCQTYRHQYLEtGTWPQ-----WFMFDEYAQv------------------qQQESHGDIV 692  Yersinia pestis
16800906  613 SQGPFEFFLATgnKAVLRKLVLTIFSHQYQDtGDWPQ-----WFMFDKYTSi------------------qQEESHGDVI 669  Listeria innocua
13476875 2416 LQDTLALLAHD--PTLARDQILNAARRQFPE-GDVQH-----WWLPRTGAG--------------------VRTLISDDV 2467 Mesorhizobium loti
15893898 2476 LWLPYVTIDYIKGTGDLSILDEVVPYIEDEPLkegederyslTKVSDKTGTIYEHCIKAIDKAL-KFGIHNIPLMGS-GD 2553 Clostridium aceto...
15889981 2418 VWLAYAINQYVSATGDAAILDESIPFLKGPALmpgqhdaffqPETSERSATLYEHAALALDLAIhRTGENGLPLILG-GD 2496 Agrobacterium tum...
17988120 2474 VWLSYGASLYVETTGDRSILDEKLPFLEGRKLeegehdafyePEISKETASLYEHCALALDLAVaRTGKHGLPLILG-GD 2552 Brucella melitensis
17380408 2449 VWLAHAVAHYCAVTGEEDILKEKVPFITGPALeegqhdsfykPDVADEVGDVYEHCARALDLAIhRTGANGLPLILG-GD 2527 Sinorhizobium mel...
15644591  419 LWLILSTSAYIKETGDWSILGEEVPFDNDP----------------NKKASLFEHLKRSFYFTVnNLGPHGLPLIGR-AD 481  Thermotoga maritima
15640632  429 LWIVPTILNYVKETGDFAFIDEVIPYADGG----------------N--ATVYEHMMAALDFSAeYVGQTGICKGLR-AD 489  Vibrio cholerae
16120936  693 VWPLKALADYLLATDRVALLDTRLSYTSIKQN----------FAFTGEQETLLQHVQRQIDHIVaHLVPGTYLSSYGdGD 762  Yersinia pestis
16800906  670 VWPLKIIGDYLEMSGDAGILEEAIPFVDRES-----------KTFTKEQGTLLEHIELAVKTIEaRFMKGTALSNYGdGD 738  Listeria innocua
13476875 2468 VWLAHATARYLSVTGDAAILKEQLPFIDGQALgegehdafftPEISKKTVSLYDHCARALDLAIkRSSPAGLPLILG-GD 2546 Mesorhizobium loti
15893898 2554 WNDGMNT----------------VGNKGKGESVWLGWFLYSILQNFKDIAKLKNDD-------YRSGRYLELSDFIRESI 2610 Clostridium aceto...
15889981 2497 WNDGMNR----------------VGVGGKGTSVWLGWFLAGALRDFIEIAEKRGDT-------DRVGKWASHREKLRHVL 2553 Agrobacterium tum...
17988120 2553 WNDGMNL----------------VGVKGKGESVWLGWFLAYTLKAFIPLAEARKDQ-------KRADLWKAHVESLTAAL 2609 Brucella melitensis
17380408 2528 WNDGMNR----------------VGEAGEGTSVWLGWFLAGTLRAFLPYARARKDK-------PRVALWERHLEALKDAL 2584 Sinorhizobium mel...
15644591  482 WNDCLNLncfsknpdesfqttvnALDGRVAESVFIAGLFVLAGKEFVEICKRRGLE-------EEAREAEKHVNKMIETT 554  Thermotoga maritima
15640632  490 WNDCLNL-------------------GG-GESSMVSFLHFWALESFLELSRYRNDE-------AATDKYQAMADGVREAC 542  Vibrio cholerae
16120936  763 WDDTLQP-----------------ANQSLRENMVSGWTIPLTLQTLKTLTKALQAYpqfadfiARIVTLTSNMEADYHKY 825  Yersinia pestis
16800906  739 WDDTLQP-----------------ANAQLKKNMVSSWTVALTYQTFKRLAAFLPVG-------EKYETLAKNVQADFAKY 794  Listeria innocua
13476875 2547 WNDGMNR----------------VGEHGKGESVWLGWFLLKTLGDFAAVAKSEGDI-------KRAQAWAKHAEALKRAL 2603 Mesorhizobium loti
15893898 2611 DKNAWD--GNWYRRAYFDDGTPLGSAQNDECQIDS--LSQSWALISGGGKT-DRAKVAMQSIEKYLVKEDRgmILLLTPP 2685 Clostridium aceto...
15889981 2554 ETAGWD--GSYYRRGYFDDGTPLGSASSEECQIDS--LGQSWSVLSGEGEE-GRSRQAMDAVMEHLVDEKTgiIRLFTPP 2628 Agrobacterium tum...
17988120 2610 DRDGWD--GEWYRRGFYDNGRPLGSKNSDECQIDA--IAQSWSVLSGVADP-KRAKKAMASLEKYLLDEDNalLRLFTPP 2684 Brucella melitensis
17380408 2585 EQAGWD--GDYYRRGYYDDDTPLGSAENGECRIDS--IAQSWSTLSGEGDK-ERSLRAMDAVMAELVDPEKriVRLFTPP 2659 Sinorhizobium mel...
15644591  555 LKYGWD--GEWFLRAYDAFGRKVGSKECEEGKIFI--EPQGMCVMAGIGVDnGYAEKALDSVKKYLDTPYG--LVLQQPA 628  Thermotoga maritima
15640632  543 ETHLWDeqGEWYIRGLTKNGDKIGTFEQVEGKVHL--ESNSLAVLSGTVSH-ERGIKAMDAVYKYLFSKYG--LHLNAPS 617  Vibrio cholerae
16120936  826 LIKDGVi-SGFIHFNQGE-AEYLLHPTDTTTQIKYrlLPAKRSIISESFDK-EMAEQHMKIIMDNLMYPDG--VRLMDRM 900  Yersinia pestis
16800906  795 MTNDTDviPGFLYLEEGKAPVWMIHPEDKETNIKYrlIPLTRSVISELVDK-KQASRNFEIIGEHLLHPDG--VRLMSEP 871  Listeria innocua
13476875 2604 ESTAWD--GEWYRRGSFDDGTPLGSRTSEECRIDS--IAQSWSVLSGEGDP-ARSTTAMRQATSLLVDDKLkiVKLFTPP 2678 Mesorhizobium loti
15893898 2686 FDDSKLNPGYIKGYVPGV---RENGGQYTHAATWVILAMTKLGEGKKAWKLFNMINPINHSRSFYDCQTYKVEPYVMAAD 2762 Clostridium aceto...
15889981 2629 FSRASHDPGYIKGYPPGV---RENGGQYTHAATWVVLALAKQGRAQEAWNCFKLLNPVNHALDAASSETYRVEPYVVTAD 2705 Agrobacterium tum...
17988120 2685 FDVTPQEPGYIKGYPPGV---RENGGQYTHGATWAILALARMGKAAEAWRLFSLISPVSHGR---NPDVYRVEPYVIAAD 2758 Brucella melitensis
17380408 2660 LETTKQDPGYIKAYPPGV---RENGGQYTHAATWVVLAFAAQERAEEAWRTFRMLNPVSHALSQVDAEHYRVEPYVVAAD 2736 Sinorhizobium mel...
15644591  629 YSRYYIELGEISSYPPGY---KENAGIFCHNNPWVAIAETVIGRGDRAFEIYRKITPAYLED---ISEIHRTEPYVYAQM 702  Thermotoga maritima
15640632  618 FATPNDDIGFVTRVYQGV---KENGAIFSHPNPWAWVAEAKLGRGDRAMELYDALNPYNQND---IIETRIAEPYSYVQF 691  Vibrio cholerae
16120936  901 AEYKAGKQTYFKRAELSAnlgREIGLQYCHAHIRFIEALCKMGMAQELYDNLFKTIPVGIQESVPNAELRQANSYFSSSD 980  Yersinia pestis
16800906  872 AHYAGGVSTHFKRAEQAAnfgREVGLQYVHAHIRYIEALAKIGD-KSAWHMLDVINPINIKEVVPNAALRQSNTYFSSSD 950  Listeria innocua
13476875 2679 FSKTQKDPGYIKSYPPGV---RENGGQYTHAATWFVIALAEMGQTDEAYRCFSMLNPVNHASDEASAEQYRVEPYVVAAD 2755 Mesorhizobium loti
15893898 2763 VYAK-----EPHVGR---------GGWTWYTGTAGWMYRVGLEGILGLKlKEGKGFTIEPCVPNKWYSYSMQYRHKNSVY 2828 Clostridium aceto...
15889981 2706 VYGE-----GAYAGR---------GGWSWYTGSAGWLYRAAVEGILGIT-RTDGKLHVSPSLPEDWSGFSIRITLDGKAR 2770 Agrobacterium tum...
17988120 2759 IYSV-----APRCGQ---------GGWTWYTGSAGWFYRVATEGILGVT-KRGDRLHFQPALPPEWEGYEAELRFGEALY 2823 Brucella melitensis
17380408 2737 IYGE-----GALAGR---------GGWTWYTGSAGWLYRAGVEGILGIR-KRGDKLLIRPVLPSEWPGYSAEVRVNGTTH 2801 Sinorhizobium mel...
15644591  703 VAGKd----APRHGE---------AKNSWLTGTAAWSFVAITQHILGIR-PTYDSLVVDPCIPKEWEGFRITRKFRGSIY 768  Thermotoga maritima
15640632  692 IMGRd----HQDHGR---------ANHPWLTGTSGWAYHATTNYILGIK-AGFDALEIDPCIPTSWPGFEVTREWRDATY 757  Vibrio cholerae
16120936  981 AKFDdryqaYNNFDQlktgavaakAGWRIYSSGPGIYINQIVSNVLGVR-YQAGDLLLDPVISRQFGDVTLNYQLYNLPV 1059 Yersinia pestis
16800906  951 AAFLdryqaQNEFGRvkegsipvkGGWRIYSSGPGIYLHQLISSVLGIR-QTEDALIFDPILPEELDGLECHIELDNYPL 1029 Listeria innocua
13476875 2756 IYAG-----DDKGGR---------GGWTWYTGSAGWLYRAAVEGILGIE-RRGKQITFRPKLPSHWDGYQASLKMLGAEI 2820 Mesorhizobium loti
15893898 2829 HIDVRRGDK-----REILLDGKVMEDR-----------IIPFLE--DGDHKVDVIIEKNI 2870 Clostridium acetobutylicum
15889981 2771 DIAVSRKAGt----ADVSVSVD-GKDL-----------AAGDG----------VIPFD-- 2802 Agrobacterium tumefaciens str. C58 (C...
17988120 2824 RVKVVAGAKa----GTIRLNGRKLAKP-----------DEGVAL--KPDGEHEIVVELPK 2866 Brucella melitensis
17380408 2802 RISVSRDSKs----GEPVVSVNNSVTK-----------NAHEG----------VLL---- 2832 Sinorhizobium meliloti
15644591  769 DITVKNPSHvskgvKEIIVDGKKIEGQ-----------VLPVFE--DGKVHRVEVVMG-- 813  Thermotoga maritima
15640632  758 QIKVENPQGvskgvKSITLNGQAIEG------------AVPVQA--AGSVNQVVVVLG-- 801  Vibrio cholerae
16120936 1060 TLRIYPQQGef-tpKRVLLDGQSLAFTl---------qDNPYRSgaALIHRQEIEGRLTA 1109 Yersinia pestis
16800906 1030 DLTFESADE-----GSIVVNGEKQPVEnganlyrtgalILPKKN--LTTKCSQITIKFQK 1082 Listeria innocua
13476875 2821 KVHVVRDKKt----KTISLEVDGSKTK-----------SASFEP--KAGTKTEVLVKIPA 2863 Mesorhizobium loti
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap