Conserved Protein Domain Family
Cah

?
COG3338: Cah 
Carbonic anhydrase [Inorganic ion transport and metabolism]
Statistics
?
PSSM-Id: 225875
View PSSM: COG3338
Aligned: 9 rows
Threshold Bit Score: 295.496
Threshold Setting Gi: 15645800
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15612923   1 MKKYLWGktclVVSLSVMVTACSSAPSTEpvdepsetheetsggaheVHWSYTGDT-GPEHWAELDSEYGACAQGEEQSP 79
gi 15645800   1 MKKTFLI----ALALTASLVGAENT-----------------------KWDYKNKEnGPHRWDKLHKDFEVCKSGKSQSP 53
gi 15603770   1 MKKSNLF----VLTLGALALTACTSPLKKee--------------thTHWGYTGHE-SPEHWAELSPKFRICGEGKNQTP 61
gi 16262474   1 MERRDFLr--gLALLAACPLCVKTAYAAEg-----------------VHWRYEGEE-GPEHWGSLAKENSACSAGSQQSP 60
gi 15601042   1 MKKTTWV----LAMVASMSFGVQAS-----------------------EWGYEGEH-APEHWGKVAP---LCAEGKNQSP 49
gi 5915867    5 LYRRQLLkllgMSVLGTSFSSCVTSPARAk----------------tVNWGYIGKV-GPEHWGELSPDFALCQIGRKQTP 67
gi 15612177   1 MKKTFLI----ALALTASLIGAENT-----------------------KWDYKNKEnGPHRWDKLHKDFEVCKSGKSQSP 53
gi 16799881   1 -------------------MTKEKV-----------------------LWGYDEKT-GPEMWGHICSDFEIAHTGKAQSP 37
gi 13475340   1 MHRRNLIr--aFIALGVCPICAQTARAAS------------------AHWGYGGSV-GPEHWADLDTRNFACSAGRQQSP 59
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15612923  80 IN--LDKAEAVD--TDTEIQVHYEP-SAFTIKNNGHTIQAETTSDGNTIEIDGKEYTLVQFHFHIPSEHEMEGKNLDMEL 154
gi 15645800  54 IN--IEHYYHTQ--DKADLQFKYAAsKPKAVFFTHHTLKASFEPT-NHINYRGHDYVLDNVHFHAPMEFLINNKTRPLSA 128
gi 15603770  62 ID--IKHTIDG---KLAPIKLDYRP-SNVEIVNNGHTIQVDFKEASNRMQLNGKTFTLKQFHFHVPSENLIRGKSFPMEA 135
gi 16262474  61 ID--IRGAVKA---DIPELTADWK--SGGTILNNGHTIQVNAAGG-TLRRGD-KSYDLVQYHFHSPSEHFVDGKSFPMEA 131
gi 15601042  50 ID--VAQSVEA---DLQPFTLNYQG-QVVGLLNNGHTLQAIVR-GNNPLQIDGKTFQLKQFHFHTPSENLLKGKQFPLEA 122
gi 5915867   68 IDlqIADVKDVHssSQDLLVTNYQP-TALHLINNGKTVQVNYQPG-SYLKYAHQKFELLQFHFHHFSEHRVDGKLYDMEL 145
gi 15612177  54 IN--IEHYYHTQ--DKADLQFKYAAsKPKAVFFTHHTLKASFEPT-NHINYRGHDYVLDNVHFHAPMEFLINNKTRPLSA 128
gi 16799881  38 VN--IEQADVVK--LKPSTMKFYYKeTDYTIKRIEQSVHVFPHDKEQGLRFNGEYYPLVSFHAHIPAEHLLDGYVYPIEW 113
gi 13475340  60 ID--IAGTVKA---DIPRIDISWLK-GGGRMVNNGHTIQINMPEGSTLTRGD-RVYQLAQLHFHAPSEHHVAGMSFPMEA 132
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 15612923 155 HFVHKNEN-DELAVLGVLMKAGEENEELAKLWSKLPAEETEENIsLDESIDLNALLPESKEGFHYNGSLTTPPCSEGVKW 233
gi 15645800 129 HFVHKDAK-GRLLVLAIGFEEGKENPNLDPILEGIQKK--QN---FKE-VALDAFLPKSINYYHLT--ALSPLLLAQRGW 199
gi 15603770 136 HFVHADNE-GNLAVLGVLYVLSSENQRLAPIWQNFPQKAGEKYT-LSTAFDPATLIPKKRDYYRFSGSLTTPPCSEGVNW 213
gi 16262474 132 HFVHKNAEtGTLGVLGVFLVPGAANSTFASLAEKFPRNPGEESP-LIT-IDPKGLLPSSLSYWTYEGSLTTPPCSEIVDW 209
gi 15601042 123 HFVHADEQ-GNLAVVAVMYQVGSENPLLKVLTADMPTK-GNSTQ-LTQGIPLADWIPESKHYYRFNGSLTTPPCSEGVRW 199
gi 5915867  146 HLVHRSKS-GDLAVMGIFLQAGAFNPTLQIIWDATPQNQGTDKRiEDINIDASQFLPAQHRFFTYSGSLTTPPCSENVLW 224
gi 15612177 129 HFVHKDAK-GRLLVLAIGFEEGKENPNLDPILEGIQKK--QN---LKE-VALDAFLPKSINYYHFNGSLTAPPCTEGVAW 201
gi 16799881 114 HFVHEKPDgTTLVMSAWMEIDNTNNVEFKDLPTYFPEVFADFETeREITLDVNEFMPEERVFYTYQGSRTTPPTVEGVTW 193
gi 13475340 133 HFVHKDTKsDTLGVLSALLMPGATNNSFAGLAKVFPARPGEEMA-VDE-FDPNGLLPASLGYWTYEGSLTTPPCTENVEW 210
                       250       260       270       280
                ....*....|....*....|....*....|....*....|..
gi 15612923 234 TVLSEPITVSQEQIDAFAEIFP--DNHRPVQPWNDRDVYDVI 273
gi 15645800 200 HGL--------------------------------------- 202
gi 15603770 214 LVLKHYDNISQSQVEAFATLMKg-HNNRPVQPINARVIVE-- 252
gi 16262474 210 MVAMEAVEVDPGDIKKFTALYs--MNARPALAGNRRYVLSSS 249
gi 15601042 200 IVLKEPAHLSNQQEQQLSAVMg--HNNRPVQPHNARLVLQAD 239
gi 5915867  225 CVMATPIEASPAQIAKFSQMFP--QNARPVQPLNDRLVIEAI 264
gi 15612177 202 FVIEEPLEVSAKQLAEIKKRMKnsPNQRPVQPDYNTVIIKSS 243
gi 16799881 194 IVLKNAKTLGQEDFTEFEKAIG--NTSRPVQDLNGREITFYN 233
gi 13475340 211 MVAMEPVEVDTADIKRFTTLYa--SNARSIRPSNRRFILGLS 250
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap