1GH8


Conserved Protein Domain Family
EFB1

?
COG2092: EFB1 
Click on image for an interactive view with Cn3D
Translation elongation factor EF-1beta [Translation, ribosomal structure and biogenesis]
linked to 3D-structure
Statistics
?
PSSM-Id: 225003
Aligned: 15 rows
Threshold Bit Score: 71.1815
Threshold Setting Gi: 3219799
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1GH8_A    1 MGDVVATIKVMPESPDVDLEALKKEIQERI-PEGTELH-KIDEEPIAFGLVALNVMVVV-GDAEGGTEAAEESLSGIEGV 77  Methanothermobacter ...
3219795   1 MGSVMMKIRVMPSDVDVDLNEVLEKIKNIQ-MEGVEIR-DSAIQPIAFGLKAIVLMAVM-PDMEGIGDRYIEEIGKIEGV 77  Archaeoglobus fulgidus
22095646  1 MGDVAAKIKIMPESIETDLAELKEKIKAVI-PAKADLHgDIVEEPIAFGLKALIVTLIV-NDEEGGTEPAEEAFAKVSGV 78  Methanosarcina aceti...
3219799   1 MATVLAKIKIMPTSPEVNKEKLKEKIKEVLeKQDVA-IrGLFDEPLAFGLYAIYTVIEM-EEREGGTEPIENALAEIDEV 78  Methanocaldococcus j...
22095648  4 VSKVLVDLKVLPESADVDYEELKEAIREKLeSMDVVDIeGMEEEPIAFGLKAIRVKVVV-PDAEGGTDALEDALKEVDEV 82  Methanopyrus kandleri
20137840  2 SAEVALVYRVLPDSAEVNIEKLKNDVINKL-APKYKVD-KVEVEEIGFGIKALRLYIRMpESDEYSSDEIEELLRSVEGV 79  Pyrobaculum aerophilum
3219800   1 MTDVLVVLKVFPDSDEVNLDNLYTDISSKL-PKEYKII-RKETEPIAFGLNALILYVQMpEQTEGGTDNLEEVVNNIQGV 78  Sulfolobus solfataricus
13541449  4 MADVLVSFKLLPSDSDVDTSVMESEVKEKL--NGVCKInNIEEKDIGFGLKYIHLEVIV-EDKEGEVDRIEKVLSMVKGV 80  Thermoplasma volcanium
16081669  4 MGDVLVTLKILPKDTDADIKSIEDQVKRNI--EGLCSInRMDEVDIGFGLKYIKLEIIV-QDKEGEIDRVENSISSIEGV 80  Thermoplasma acidoph...
15790245 12 MSKVAAVLKVMPDSPDIDLDGLEADLSESL-PDGAEIN-GTDTEEVAFGLTALLTTVIV-PDDSGGTEAVEDAFGAVDDV 88  Halobacterium sp. NRC-1
3219795   1 MGSVMMKIRVMPSDVDVDLNEVLEKIKNIQ-MEGVEIR-DSAIQPIAFGLKAIVLMAVM-PDMEGIGDRYIEEIGKIEGV 77  Archaeoglobus fulgidus
22095646  1 MGDVAAKIKIMPESIETDLAELKEKIKAVI-PAKADLHgDIVEEPIAFGLKALIVTLIV-NDEEGGTEPAEEAFAKVSGV 78  Methanosarcina aceti...
3219799   1 MATVLAKIKIMPTSPEVNKEKLKEKIKEVLeKQDVA-IrGLFDEPLAFGLYAIYTVIEM-EEREGGTEPIENALAEIDEV 78  Methanocaldococcus j...
22095648  4 VSKVLVDLKVLPESADVDYEELKEAIREKLeSMDVVDIeGMEEEPIAFGLKAIRVKVVV-PDAEGGTDALEDALKEVDEV 82  Methanopyrus kandleri
20137840  2 SAEVALVYRVLPDSAEVNIEKLKNDVINKL-APKYKVD-KVEVEEIGFGIKALRLYIRMpESDEYSSDEIEELLRSVEGV 79  Pyrobaculum aerophilum
3219800   1 MTDVLVVLKVFPDSDEVNLDNLYTDISSKL-PKEYKII-RKETEPIAFGLNALILYVQMpEQTEGGTDNLEEVVNNIQGV 78  Sulfolobus solfataricus
13541449  4 MADVLVSFKLLPSDSDVDTSVMESEVKEKL--NGVCKInNIEEKDIGFGLKYIHLEVIV-EDKEGEVDRIEKVLSMVKGV 80  Thermoplasma volcanium
16081669  4 MGDVLVTLKILPKDTDADIKSIEDQVKRNI--EGLCSInRMDEVDIGFGLKYIKLEIIV-QDKEGEIDRVENSISSIEGV 80  Thermoplasma acidoph...
15790245 12 MSKVAAVLKVMPDSPDIDLDGLEADLSESL-PDGAEIN-GTDTEEVAFGLTALLTTVIV-PDDSGGTEAVEDAFGAVDDV 88  Halobacterium sp. NRC-1
1GH8_A   78 SNIEVTDVRRL 88  Methanothermobacter thermautotrophicus
3219795  78 ESVEIEDMELL 88  Archaeoglobus fulgidus
22095646 79 ENVQVLEAYRI 89  Methanosarcina acetivorans
3219799  79 ESVETVEVSLA 89  Methanocaldococcus jannaschii
22095648 83 NQVEVVSASRT 93  Methanopyrus kandleri
20137840 80 GGYELEYFSRL 90  Pyrobaculum aerophilum
3219800  79 SHAEVVGITRL 89  Sulfolobus solfataricus
13541449 81 GEINTENVSLI 91  Thermoplasma volcanium
16081669 81 GEISTENVSLI 91  Thermoplasma acidophilum
15790245 89 ESVSVEEVGRL 99  Halobacterium sp. NRC-1
3219795  78 ESVEIEDMELL 88  Archaeoglobus fulgidus
22095646 79 ENVQVLEAYRI 89  Methanosarcina acetivorans
3219799  79 ESVETVEVSLA 89  Methanocaldococcus jannaschii
22095648 83 NQVEVVSASRT 93  Methanopyrus kandleri
20137840 80 GGYELEYFSRL 90  Pyrobaculum aerophilum
3219800  79 SHAEVVGITRL 89  Sulfolobus solfataricus
13541449 81 GEINTENVSLI 91  Thermoplasma volcanium
16081669 81 GEISTENVSLI 91  Thermoplasma acidophilum
15790245 89 ESVSVEEVGRL 99  Halobacterium sp. NRC-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap