Conserved Protein Domain Family
NagA

?
COG1820: NagA (this model, PSSM-Id:224733 is obsolete and has been replaced by 441425)
N-acetylglucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism]
Statistics
?
PSSM-Id: 224733
Aligned: 41 rows
Threshold Bit Score: 278.766
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15594496   4 FCLFNSKSVLTGNDKIDNSAVLIKDNKIFDIVT------SDr----lKKMdleEYQMIDTKGNYITPGLYDNHIHGFHGH 73  Lyme disease spiroc...
15893481   1 MKAIINGKIITEDSILENKVLLFDEKIIDIVDE------KNl-----DRK---TTYVIDAEGNYVSPGFIDVHIHGFSGA 66  Clostridium acetobu...
19704468   3 KILLKNAKLVLENKLING-SILIFKNKIEKIFTd----nDNl----sEFI---FDEVIDLKGKYLGPAFIDVHTHGADGA 70  Fusobacterium nucle...
15673317   2 TYYIKADQFFYAYETKKGGFLEITDGKFGEWTE-------E------APA---GADILDYSGQSIAPGLVETHIHGFGGA 65  Lactococcus lactis ...
15828840     --------------------------------------------------------------------------------     Mycoplasma pulmonis
15901876   2 PNYIKADQFFYPHGVRRGGYLELVDGKFGKHVE-------Q------IPE---GAEVIDYTGYSIAPGLVDTHIHGYAGV 65  Streptococcus pneum...
15675552   2 TCYLKADCFYYPTEVRPAGYLSLHDGVFGEWTE-------I------VPA---DAQIIDYTGYQIAPGLVDTHIHGYAGA 65  Streptococcus pyoge...
15899396  14 LNTRMKLRVSYTVRWVKVSKCIRGLEIITPLESfrddivISdgeirkIGSgicNEEIKVDRGKYVIPGMIDIHTHGIGGI 93  Sulfolobus solfatar...
15643577   1 -MIVEKVLIVDPIDGEFTGDVEIEEGKIVKVE---------------------KRECIPR--GVLMPGFVDPHIHGVVGA 56  Thermotoga maritima
16801278   1 MAIIKNVKVYKESELINA-TVITEGNLIAEVFP------SNk----iIPEkysTEQIFDGNGQLLIPGMIDVHIHGAKNY 69  Listeria innocua
15594496  74 GTDQ-CSTESILKMSEHLAQYGVVGFLPTLYPRPIDEMIKTIKACIAAIGk-EKGAKILGLHLEGPFFSPEKKGAHPVSY 151 Lyme disease spiroc...
15893481  67 DTMD-GTLDALKTISRDITKNGVTSFLPTTMTMDRQKIYTALDTIREASTkcLGGANILGAHLEGPFISEKFKGAQAKTH 145 Clostridium acetobu...
19704468  71 DAMD-GNEEALRKISSYLVKEGTANFLATTLTSTKEILKDVLEVVANLQDkdIEGANIFGVHMEGPYFAIEYKGAQNDKY 149 Fusobacterium nucle...
15673317  66 DAQDaEVEGIMGTMSEGLLSAGVTSFLPSPLTDDHEGLKAVCTVVGEHYQe-ARGAKVRGIFFEGPFFTEEKKGAQNPKY 144 Lactococcus lactis ...
15828840   1 --------------------------------------------------------------MEGPFISKEKKGAHDENI 18  Mycoplasma pulmonis
15901876  66 DVMDnNIEGTLHTMSEGLLSTGVTSFLPTTLTATYEQLLAVTENLGNHYKe-ATGAKIRGIYYEGPYFTETFKGAQNPTY 144 Streptococcus pneum...
15675552  66 DVMDnSAQG-IHQMSEGLLATGVTSFLPTTLTSTFEQLEKVSGTIASVADq-VKGAKIQGIYFEGPYFTEEYKGAQNPSY 143 Streptococcus pyoge...
15899396  94 LVNDiRSINDYEKMVSYYYSHGVTTFIPSTISENVEKLVSIARVLNEVKS--------IGIHLEGPLINPNRAGAHKFFT 165 Sulfolobus solfatar...
15643577  57 DTMN----CDFSEMEEFLYSQGVTTFLATTVSTSLEKMKEILRKARDYILe-NPSTSLLGVHLEGPYISKEKKGAHSEKH 131 Thermotoga maritima
16801278  70 DMMD-GSTESIQAVSMACAETGCTSFLVTSVSSSLEDLIQMIKQTKKVVGk-EQGAKIAGIHLEGPYLNIEKKGMQNPAY 147 Listeria innocua
15594496 152 LHEPSIEVMQKLIDAAGGvFtgsngkrkthISTMTVAPELKGMRELAIFCLE-NNINLQAGHTNATYENMIEGFQVGILH 230 Lyme disease spiroc...
15893481 146 ILKPDYDFIKDYIDIIK-------------I--ITLAPEEDENLEFIKTVKKnSDIVLSIGHSNASYDEAVNAIKNGINH 210 Clostridium acetobu...
19704468 150 MKPAGIKELEEYLSVKDG-L----------VKLFSISPHNQENLEAIKFLAD-RGVVASVGHSGASYEAVMKAVDYGLSH 217 Fusobacterium nucle...
15673317 145 MRDAKMWELEDWQEAAHG-M----------LKKIGLAPERDGSEDFIRKATE-SGVVIALGHSNATYKQAVAGVQAGASV 212 Lactococcus lactis ...
15828840  19 IIPLNEKYLEFFKKQKNl------------KTTIVVAPEEN-DYKLIKKYSS--DFHFSIGHSNCFDFSKKFNLKY-FKS 82  Mycoplasma pulmonis
15901876 145 MRDPGVEEFHSWQKAANG-L----------LNKIALAPERDGVEDFVRTVTG-EGVTVALGHSNATFDEAKKAIDAGASV 212 Streptococcus pneum...
15675552 144 MKTPRLEEFDAWQKAAKG-L----------IKKIALAPERDGVKEFVSAVTK-QGVTVALGHSNGTYQEAKEAVQAGASV 211 Streptococcus pyoge...
15899396 166 RFDERILEISKLFKIKR----------------ITIAPEILSDKELENLADN---FQVSLGHTDANSDDTRRAIGFGASS 226 Sulfolobus solfatar...
15643577 132 IRPPSERELSEIDSPAK---------------MLTFAPEIE-SSELLLRLVK-RDIVLSAGHSIATFEEFMKFYKEGVKR 194 Thermotoga maritima
16801278 148 LRHPDLKEMKQIFDEADG-L----------IKMVTIAPELPGGIELIDFLKK-RGVVIAIAHSNATYEEAQDAFEKGATH 215 Listeria innocua
15594496 231 TTHFFNAMSKLDHRNPNAIGAVLIHG---DVSCEIIADGHHIHPKLILMLRKLKDISKIVLVTDGLTPNCQTCGKLIANG 307 Lyme disease spiroc...
15893481 211 VTHMFNAMTPLTHRNLGVIGAIFNN----NIPSEIIADKIHLHPDIYKILIKTIGTNNITLITDCMRAGGLGDGVSELGG 286 Clostridium acetobu...
19704468 218 ATHTYNGMKGFTHREPGVVGAVFNSD---NIMAEIIFDKVHVHPEAVRTLIKIKGVDKVVCITDSMSATGLAEGQYKLGE 294 Fusobacterium nucle...
15673317 213 WVHTFNGMSGMTHQEPGMVGAILNTP---NTYAELICDGHHVRPEAAEIVMKMKGADHVVLITDSMRAAGLPDGPYMLGE 289 Lactococcus lactis ...
15828840  83 FTHFFNGSSGFDHKKEGLINTIFSQKlpsDFLVEIISDGIHVSSQVLKLTYQILNIKNLIVVSDSLSPKGLKDGVYFLGN 162 Mycoplasma pulmonis
15901876 213 WVHAYNGMRGLTHRELGMVGAMYQLP---HTYAELICDGHHVDPKACEILIKQKGTENIALITDCMTAGGLEDGDYMLGE 289 Streptococcus pneum...
15675552 212 WVHAYNGMRGLTHREPGMVGAVYNLP---NTYAELICDGHHVSPIACDILMQQKGHDHVAMITDCMRAGGSPDGDYLLGE 288 Streptococcus pyoge...
15899396 227 VTHLFNAMRPFHHRDPGIIGVSLTSP----IYAEVISDLVHINEITLSIVSKLK-GDKTILVTDSLQAAGLGEGEFLLYG 301 Sulfolobus solfatar...
15643577 195 ITHFPNGLKPLHHREIGITGAGLLLD---DVKLELICDGVHLSREMVKLVYKVKKANGIVLVTDSISAAGLKDGTTTLGD 271 Thermotoga maritima
16801278 216 ITHCFNAMPAIHHRAPGLVTAALEND---AVSVQTIVDGVHLHPGIVRLIHKIKGPDKIVLTTDALQAMGVGDGEYIFGG 292 Listeria innocua
15594496 308 DEVYIAEDglFHSVKSNTIAGSTLTMIQGLKNLIEFGFSLS-DAVQASSYNPTRILNIDKK-GLICHGYDANLNVLDKDF 385 Lyme disease spiroc...
15893481 287 QKVIVKDD--SARLENGTLAGSILTLNKAIKNVYENTDLKLnEAVKLATINPAKNINVFDKkGSLNNGKDSDITIFNDAF 364 Clostridium acetobu...
19704468 295 LDVNVKDGq-ARLVSNNALAGSVLRMDIAFKNLIELGYSIT-DAFKMTSTNAAKEFKLNt--GILKEGKDADLVVLDKDY 370 Fusobacterium nucle...
15673317 290 YEVEVRDGa-AWLP-TGRPAASILTLKTAVKNVIDWGIATPaEAIMMASLTPAKSVNIDDVcGQIKPGLSADFIVLDNDF 367 Lactococcus lactis ...
15828840 163 LEIKKENKt-FYLNKQNTIAGSALEYNKNLNFFKESTNASWtDIVYVSSYNLAKNLKLQNKyGTIKVGQKANLVLIDKDF 241 Mycoplasma pulmonis
15901876 290 FPVVVANGt-ARLKSTGNLAGSILKLKDGLKNVVEWGIANPhEAVMMASFNPAKSVHIDDVcGQIREGYDADFIVLDKDL 368 Streptococcus pneum...
15675552 289 FSVVVANGt-ARLKESGNLAGSILKLKDGLRNVVAWGIATPaEAIHMATYVPAVSVGIDDVcGQIKAGHAADFIVLDKDL 367 Streptococcus pyoge...
15899396 302 EKITCDKA--CFEA-NKRLVGSNITLDEGVRRVSKIIGLRE--AIKYVTYSPASLLN-LEKiGQISRGYVADLVILDENL 375 Sulfolobus solfatar...
15643577 272 LVVKVKDG--VPRLEDGTLAGSTLFFSQAVKNFRKFTGCSItELAKVSSYNSCVELGLDDR-GRIAEGTRADLVLLDEDL 348 Thermotoga maritima
16801278 293 HQVTVKEG--IARLQDGTLASSTVTMNKSLR-LSNEFGISLqDSIQMATSTPAEILGMK-KfGRIEKGYIADLVLLDEKF 368 Listeria innocua
15594496 386 NLKLTMIESKIIFN 399 Lyme disease spirochete
15893481 365 EIKLTIIGGDIIEN 378 Clostridium acetobutylicum
19704468 371 KVCMTMVKGKIKFT 384 Fusobacterium nucleatum subsp. nucleatum ATCC 25586
15673317 368 DLVATYLDGEKRYE 381 Lactococcus lactis subsp. lactis
15828840 242 NILFTYVNGKKY-- 253 Mycoplasma pulmonis
15901876 369 ELVATYLDGVKRYQ 382 Streptococcus pneumoniae TIGR4
15675552 368 TLVATYLNGQKAFD 381 Streptococcus pyogenes M1 GAS
15899396 376 NVLTTLKSGSIVFS 389 Sulfolobus solfataricus
15643577 349 NVVMTIKEGEVVFR 362 Thermotoga maritima
16801278 369 EVLTTWINGEKY-- 380 Listeria innocua
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap