Conserved Protein Domain Family
YyaL

?
COG1331: YyaL (this model, PSSM-Id:224250 is obsolete and has been replaced by 440942)
Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only]
Statistics
?
PSSM-Id: 224250
Aligned: 24 rows
Threshold Bit Score: 488.802
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
15790345  22 MTHPTARNRLDEAASPYLRQHAD----NPVNWQPWGEPAFSAAREHDVPIFLSIGYSACHWCHVMAEESFADPEIAAVLN 97  Halobacterium sp. N...
11499326   1 -----MVNRLINSRSPYLRKAAN----QPVEWFEWGEEAFAKAKKEDKPILLSIGGVWCHWCHVMAKESFENEEIAEMIN 71  Archaeoglobus fulgidus
14602126   1 --------------------------------MPWGAEAFEKARRLDKPVFVSVGYSSCHWCHVMQRESFSDPMVAEVLN 48  Aeropyrum pernix
17986289  31 PMAEPDSNRLAGEPSAYLRQHAN----NPVHWQPWGRKALDAAKELDRPILLSIGYAACHWCHVMAHESFEDDDVAAVMN 106 Brucella melitensis
15805870  10 GLACPMPNRLAQESSPYLLQHQD----NPVDWWPWSPEAFAEARQRDVPVLLSVGYSTCHWCHVMAHESFENERTAAFMN 85  Deinococcus radiodu...
15840520   3 PANPSGTNTLALATSPYLRQHAD----NPVHWQQWTPQALAEAAARAVPILLSVGYAACHWCHVMAHESFDDDEVAAAMN 78  Mycobacterium tuber...
18313540   1 --MDARERCLSSSSSPFVLEGLK----SRVKWWGWCKEAFEAAEREDKPVLVDVGAVWCHWCHVMDERTYNDEEVAEFIN 74  Pyrobaculum aerophilum
15608224   3 PANPSGTNTLALATSPYLRQHAD----NPVHWQQWTPQALAEAAARAVPILLSVGYAACHWCHVMAHESFDDDEVAAAMN 78  Mycobacterium tuber...
15898979  11 TKNIRMNERLMNSQSGYLRKAVN----HPINWYTWSNDVFEIAKKENKPILIDVGAAWCHWCNVMDEDTYSNPEIAKIVN 86  Sulfolobus solfatar...
15790794  16 PVPFGGPKPFPGGDAEYCRMSDAsddrTRVEWREWGSDAFADARERGVPLLVSVVATWSESCRAMAQRTYAEPRIAANIN 95  Halobacterium sp. N...
15790345  98 EQFVPVKVDREQRPDVDDLYMTVSQVTRGSGGWPLSVFLTPERKPFYITTYVPKEPTRDQPGFESLLEDVTANWRENRGD 177 Halobacterium sp. N...
11499326  72 RNFVAIKVDRDERPDIDKRYQEFVMATTGSGGWPLTVFLTPDGKPFFGGTYFPPEDRYHLPGFKTVLRKIAEMWRHDRER 151 Archaeoglobus fulgidus
14602126  49 RAFVMVKVDREERPDVDTLLMRYCAIASGSCGWPLNVLLTPDGKPFYVATYLPKE------SLVALAVSLERVWRERRAE 122 Aeropyrum pernix
17986289 107 AFFINVKVDREERPDIDQIYMAALGAMGQQGGWPLTMFLRPDGKPFWGGTYIPRHARHNMPGFVDILHAVNNLWHRDKDK 186 Brucella melitensis
15805870  86 AHFVNIKVDREERPDVDAVYMAATQALTGQGGWPMTVFLTPDAEPFYAGTYFPPQEGMGMPSFMRVLASIDDVWQNRRDQ 165 Deinococcus radiodu...
15840520  79 AGFVCIKVDREERPDIDAVYMNATVALTGQGGWPMTCFLTPNGRPFFCGTYYPK------AAFLQLLSAISETWRERRAE 152 Mycobacterium tuber...
18313540  75 KHFIPVKVDRDERPDVDRRLQEAAQLISGQSGWPLTVFMTPKGQVIWAATYLPPRREMGLPGMLEVLEAVLRAYREKRGE 154 Pyrobaculum aerophilum
15608224  79 AGFVCIKVDREERPDIDAVYMNATVALTGQGGWPMTCFLTPNGRPFFCGTYYPK------AAFLQLLSAISETWRERRAE 152 Mycobacterium tuber...
15898979  87 ENFIPVKVDRDEMPDLDRLLQNAAMAITGESGWPLTIFMTPEGKVFFGGTYFPPEDRYGRIGFKRLLLEILRIWREDRNQ 166 Sulfolobus solfatar...
15790794  96 DDFVPVRVNAARRPRVRERYN--------MGGFPSTVFVTPDGEHIAGATFLEPD------GFRQVLQRVRETWD-DAGA 160 Halobacterium sp. N...
15790345 178 LDARAEQWLQAARGELesVPDPVDDAGTDSp-LPAAAGSIADAADATHGGFGRGQKFPHAGRLRVLLRATQRdAGDgARA 256 Halobacterium sp. N...
11499326 152 LLKSAEELTEAVRRYA--EGSFKGDVDEKL--LDKGIEAVLDQTDYVNGGFGSAPKFHHAKAVELLLTHHFF-TGD-EEV 225 Archaeoglobus fulgidus
14602126 123 VLEVAERAGGLLEQHR--LAFTPGRIPRPGeiLGKAVSSLEKVYDTAYGGFGRGMKFPMHHALLLLARASMA--GD-RRA 197 Aeropyrum pernix
17986289 187 INHNAEAVFDHLEGR---LAAQSQPLQNEIsrFDDLANRIGSLIDPQRGGIEGVPKFPNAPFMDTLWLSWLY-RHN-ETH 261 Brucella melitensis
15805870 166 ALGNAQALTEHVRGASq-PTRREGELPGGA--LARAVENAARLYDAQFGGFGRAPKFPAPSTLDFLLT------Q--PQG 234 Deinococcus radiodu...
15840520 153 VEQASDHIAAELRSMAsgLPGGGPEVAPEL--CDDAVAGVLREQDTAHGGFGGAPKFPPSALLEALMRHYER-TRS-PAA 228 Mycobacterium tuber...
18313540 155 VEKFHEDLARELKKWH--SPSPGEPRREGQ--A-EVLAALAASFDEEYGGFGGAPKFPPITQLELLMMRHFY--DGvGIY 227 Pyrobaculum aerophilum
15608224 153 VEQASDHIAAELRSMAsgLPGGGPEVAPEL--CDDAVAGVLREQDTAHGGFGGAPKFPPSALLEALMRHYER-TRS-PAA 228 Mycobacterium tuber...
15898979 167 ILLSSIDPNMLIP------KNTGGVLNSSV--LDDAFSFITSYFDIEYGGLGFGAKFPHPFVDLLFLNYSAT-RGD-DLG 236 Sulfolobus solfatar...
15790794 161 DAGSVPRALSGGE-----PPAAPLSGDIEG----LVAGQLADQYDSEHAGWGSSEKFPLPETVSFALK----------RD 221 Halobacterium sp. N...
15790345 257 ASAARHTLTAMADGGLHDHVGGGFHRYCTDREWTVPHFEKMLYDQAALARLYVDGYRALGDSRYADVARSTLTFVDRELG 336 Halobacterium sp. N...
11499326 226 LKAAEITLDAMARGGIYDHLLGGFFRYSTDAKWVTPHYEKMLYDNAELLYLYSIAYALTGKRLYQKIADGIVEYYRKFGC 305 Archaeoglobus fulgidus
14602126 198 LNMLTGTLDHMLFSGVHDLVEGGLHRYSVTRDWRLPHYEKMLYDQAWIIQVLAEAYAASGDRLYLDFAVSTLEFAMSWLW 277 Aeropyrum pernix
17986289 262 RDNFLLSLKTMLQGGIYDHLGGGLCRYSTDAEWLVPHFEKMLYDNAQFIRHANYAFAETGDDLFRIRIEETVDWLIREMQ 341 Brucella melitensis
15805870 235 REMALHTLRMMGAGGIYDQLGGGFHRYSVDAQWLVPHFEKMLYDNAQLVRTLLRAYQLTGEDDFARLARETLAYLEREML 314 Deinococcus radiodu...
15840520 229 LEAVARTGNAMARGGIYDQLGGGFARYSVDGAWVVPHFEKMLYDNALLLRAYAHWARRTGDPLARRVAAQTARFLLDELG 308 Mycobacterium tuber...
18313540 228 GKMAERTLDAMALGGVYDQLLGGFFRYSTDRSWLIPHYEKLLIDNAELLAVYTKAYRQFGKALYKRTAEGIVKWLDEFMR 307 Pyrobaculum aerophilum
15608224 229 LEAVARTGNAMARGGIYDQLGGGFARYSVDGAWVVPHFEKMLYDNALLLRAYAHWARRTGDPLARRVAAQTARFLLDELG 308 Mycobacterium tuber...
15898979 237 KKLGLFTLRKMYYGGIFDQVGGGFHRYTVDREWKLPHFEKLLIDNAELIYDYFTYYIATNDIEILDALRNSVDFVLRELY 316 Sulfolobus solfatar...
15790794 222 RDRALRTLDAIRRHLVGD--DGGCFRFAHGRDWSDPQTERTLSVNAGMLAAFAHAYLTTGDDEYRGAATGVLDYLTETLW 299 Halobacterium sp. N...
15790345 337 HPDGG--FYATLDARSPPpdapdgdrEEGAYYVWTPNRVAAAMRdhaaaapcdtadadVLADAACRRYGVDDTGNFEa-- 412 Halobacterium sp. N...
11499326 306 SNEGG--FYASQDADIGEl-------DEGGYYLFSDRELKEILDe-------------REFRIATLYYDIQGERKLP--- 360 Archaeoglobus fulgidus
14602126 278 TGRG---FASSVDADTGE--------GEGAYYTFTLEEAEAEGG---------------LPPEAIGLFNLSREGNVFeea 331 Aeropyrum pernix
17986289 342 LPDGc--FASSLDADSEG--------EEGKFYVWTEDEIDAVLG--------------TDAEVFKTFYAVTPGGNWE--- 394 Brucella melitensis
15805870 315 APDGG--FYSAQDADTPTeh----ggVEGLTFTWTPDEIRAVLG--------------EDADLALRSFNVTAQGNFRdph 374 Deinococcus radiodu...
15840520 309 SKAPAdmFTSSLDADADG--------REGSTYVWTPVQLTEVLGg-------------DDGRWAAEVFGVTEAGTFEh-- 365 Mycobacterium tuber...
18313540 308 APEGG--YYASQDADVDG--------EEGGYYRWSLEELKELLG--------------ELYPVASKHFGLEEYPWPE--- 360 Pyrobaculum aerophilum
15608224 309 SKAPAdmFTSSLDADADG--------REGSTYVWTPVQLTEVLGg-------------DDGRWAAEVFGVTEAGTFEh-- 365 Mycobacterium tuber...
15898979 317 IDGKG--FANSLDADSEG--------MEGKYYTWTEDELKDSLG--------------NDYGIAIRVFDLKNTVEVE--- 369 Sulfolobus solfatar...
15790794 300 T------------GAAFG---------AGETPDGGVDDAAYADG------------------------------------ 322 Halobacterium sp. N...
15790345 413 -----GTTVPTVSASVGAiAdafdtaPATAEAWCDVIDARLRAARADR-PRPARDEKVLAGWNGLMARAYAEAGLALDDR 486 Halobacterium sp. N...
11499326 361 ------RIFLTEEEISKIlGv----sVEEVERAVNSARRKMLEFREQR-EMPYIDTTIYAGWNGLMIEALCMHHKVFGDN 429 Archaeoglobus fulgidus
14602126 332 tgartGRNILHVGGRLDRaAemlglsPDRAWEVLEESRRILLRIRSRR-EKPGVDDKVLTDWNGMMLHALAHLYWVSRDP 410 Aeropyrum pernix
17986289 395 -----GKNILNRLHAAAEt--------PTPPPLVEAARRKLLAHRETR-IRPGRDDKALTDWNGLAIRALAEAGRSFART 460 Brucella melitensis
15805870 375 qpaygSRNVLHTPTPLPAlAre---lgDDAAQRLQAARAKLFAARQVR-PQPHTDDKVLTSWNGLVLAALADAARILGEE 450 Deinococcus radiodu...
15840520 366 -----GTSVLQLPADPDD------------AARLDRVRAALLVARLAR-AQPARDDKVVTSWNGLAITALAEASVALDDP 427 Mycobacterium tuber...
18313540 361 -----GKATLRVARPLE-------------GPEAERIYQILIEARRKR-KPPFTDTTVYVGWSCAMAYAELLASRLASVG 421 Pyrobaculum aerophilum
15608224 366 -----GTSVLQLPADPDD------------AARLDRVRAALLVARLAR-AQPARDDKVVTSWNGLAITALAEASVALDDP 427 Mycobacterium tuber...
15898979 370 -----GRKVLLRTIELRElCkatglqVNDMIKKISEIRTKLLAYRKQNrKMPYRDDNTYTYSNAKLAESMLYSSLILNKS 444 Sulfolobus solfatar...
15790794 323 --------------------------------------------------------------NALAADALLSLAAYTGDD 340 Halobacterium sp. N...
15790345 487 -FAERAADAIAFARDTLWDGd-RLARRSIGGDV-AGVGYAADYAFLAAGALATYEATGAVAHLDFALDLADAMLEACYDA 563 Halobacterium sp. N...
11499326 430 wSLEMAEKTANRLLKEFWDG-----RELLHTHN--VEGLSEDYIFFARGLLALFEVTQRHEYLEKCFEIVDSAVEKFWDG 502 Archaeoglobus fulgidus
14602126 411 eVLGVAKSLKALVKDRMNGD--GISHVCYSGGE-CVEGMLPDYAYTAAALASLYTVSGDTEALGAAKSLAKGMIDLLWSP 487 Aeropyrum pernix
17986289 461 dWLEHAVQAYRSIGSSFQDG--RIAHCRMEGAF-LYPALATDPEVQART------------------------------- 506 Brucella melitensis
15805870 451 kYLDLARRNADFVHRELRLPggTLRHTFKDGRA-SVEGLLEDHALYGLGLVALFQAGGDLAHLHWARELWNIVRRDFWDE 529 Deinococcus radiodu...
15840520 428 aLAHAARRCATRLLDLHVVDg-RLRRASLGGVVgDSAAILEDHAMLATGLLALYQLTSEGAWLTAATGLLDTAVAHFGDP 506 Mycobacterium tuber...
18313540 422 nKYHAVRTLERFGVELGQRG--RLPRGFRGGGP-VGIAALEDYAYCILAWIEGYSHTAKLEFLKVAESAGEILLAKFLEE 498 Pyrobaculum aerophilum
15608224 428 aLAHAARRCATRLLDLHVVDg-RLRRASLGGVVgDSAAILEDHAMLATGLLALYQLTSEGAWLTAATGLLDTAVAHFGDP 506 Mycobacterium tuber...
15898979 445 --IEEAKLVLSKLGKTVSRR--------LDGGK---AGLPEDYAAALLATISAYEVLGEERYYDLAIELGRNI------- 504 Sulfolobus solfatar...
15790794 341 rATRYAERTLDYIADELLVD---DTVRHYAGAA-APVGLLADRARVTGALTTAGQVL-DPAYLEPARAVADRAIADLQDD 415 Halobacterium sp. N...
15790345 564 S-AGvLYETPASVDDVAVRSQATGTGSTPSPIGVAADTLDALAAFAP---AAGYDDAAAALLSRYGSHIEESPGRHPELV 639 Halobacterium sp. N...
11499326 503 EdGG-FFD--SERAVLGIRLKNFHDSPTQSVNGSAPQLLLALSAITG---ERRYEELAVEGLRTFAGLARRFPFSSASYL 576 Archaeoglobus fulgidus
14602126 488 G-GG-YFRLSPPGPHTPEVPAEAEDTAYPGAYATAIHALLLIHRATG---WMKAREVAMKSLKRLASRLEQEPAAHATLA 562 Aeropyrum pernix
17986289     --------------------------------------------------------------------------------     Brucella melitensis
15805870 530 G-AGvFYSSGGHAETLLTRQASFFDSAILSDNAAAALLGVWMNRYFG---DAEAEAIARRTVQSFHAELLAAPTGLGGLW 605 Deinococcus radiodu...
15840520 507 QrPGrWFDTADDAERLMLRPSDPLDGATPSGASSIAEALLTAGHVVDgarAERYWQLAADTLRAHAVLLARAPRSAGHWL 586 Mycobacterium tuber...
18313540 499 G--G-FKDVETVDEIIPTPNYPALDTPNFSGNAVAAIALATLSEVTG---DAKYKEAAYRAVSALYGKMERVGPAASGLW 572 Pyrobaculum aerophilum
15608224 507 QrPGrWFDTADDAERLMLRPSDPLDGATPSGASSIAEALLTAGHVVDgarAERYWQLAADTLRAHAVLLARAPRSAGHWL 586 Mycobacterium tuber...
15898979 505 ---G------------VIKPNNFTDMPNESANSMYIRALFKLSLLSD---EFKVDEEKIKPL--IPSLTAENSQFIAGIV 564 Sulfolobus solfatar...
15790794 416 T--GaFVDGPETGAGLLDEPLRPIDDT-----AAMADALVDLSYLTG---EARYRDAARDAIAAFAGAAERMGVQVAGYA 485 Halobacterium sp. N...
15790345 640 LAADTRAGGRREITVAAd-dLP-DAWRDAVGAAYLPDRLLSRRPPTedgldaWQSTLDQASVPplwagrtGGDdgtpRAY 717 Halobacterium sp. N...
11499326 577 LSLYTFIKGVYVV--------KtEEHFESALKLFRPFKLVIKEY-------------VDG------------------IM 617 Archaeoglobus fulgidus
14602126 563 LATLNLAPLAVEVAAPG---VAeDFRVKVLESVYNPYMVIHTYMKPed--lrGLVEYAASMTTm------GGSp---AFY 628 Aeropyrum pernix
17986289     --------------------------------------------------------------------------------     Brucella melitensis
15805870 606 QVAAFLEAPHTEIAVIGt-pAErQPLERELAWHFLPFTALAPADEG-------GDLPVLEARPg------GGQ-----AY 666 Deinococcus radiodu...
15840520 587 AVAEAVVRGPLQIAVACd--LPrSSLLADARRLAPGGAIVVGGAAG------SSALLVGRDRVa------GAD----AAY 648 Mycobacterium tuber...
18313540 573 IALDLLTLGVPRTVIVG----EsPELITAALRAYRPWHVVVPITGNw----pYKDPAVRAMLN-------GPKp---AAY 634 Pyrobaculum aerophilum
15608224 587 AVAEAVVRGPLQIAVACd--LPrSSLLADARRLAPGGAIVVGGAAG------SSALLVGRDRVa------GAD----AAY 648 Mycobacterium tuber...
15898979 565 NSISSYISGMAHVVVVDekdGLaERLHKVALLTYYPFKLVEKVDDSrt---dYVSSVIRAMIKyn----vGRS----RAY 633 Sulfolobus solfatar...
15790794 486 TAAARLSTRPLVIRVAD---DPgSELHRAALRMADHEKVVAVG--------------VDGDPG--------------TAW 534 Halobacterium sp. N...
15790345 718 VCR-RACSPPLDDAAGITEWLAEFS 741 Halobacterium sp. NRC-1
11499326 618 VCEgNTCRF-LDSTEDIINQGRLEE 641 Archaeoglobus fulgidus
14602126 629 ICHgGVCKEPLRDEDRALEEVMRLS 653 Aeropyrum pernix
17986289     -------------------------     Brucella melitensis
15805870 667 VCVnHACQLPTRDPAELARQVAAL- 690 Deinococcus radiodurans
15840520 649 VCRgRVCDLPVTSAAELATALGVPG 673 Mycobacterium tuberculosis CDC1551
18313540 635 ICAgGACSLPVREPERLEKTIEEFM 659 Pyrobaculum aerophilum
15608224 649 VCRgRVCDLPVTSAAELATALGVPG 673 Mycobacterium tuberculosis H37Rv
15898979 634 VCIgNTCSMPVSEEEKIKQLLKTKL 658 Sulfolobus solfataricus
15790794 535 LDTaDGDTDAVATPSALAALVADTA 559 Halobacterium sp. NRC-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap