Conserved Protein Domain Family
YobN

?
COG1231: YobN 
Monoamine oxidase [Amino acid transport and metabolism]
Statistics
?
PSSM-Id: 224152
Aligned: 12 rows
Threshold Bit Score: 261.986
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
16127025  51 FPGPpnlqgaRPGASVIVLGAGLAGLLAAFELRKAGYK-VQILEFQNRPGGRNWSLRG-GDSYTELGgatqkvgyaaGNY 128 Caulobacter crescen...
16078962   1 ----------------------MSGLVSASLLKNAGHR-VTILEASGRAGGRVCTLRSpFSDDLYFNa---------GPM 48  Bacillus subtilis
16125343  46 TELPptltggAKNTKVIILGAGLAGMTAAYEMSKAGYQ-VQILEARDYAGGRCQTARK-GFKHTDLLgntqvcefddGHY 123 Caulobacter crescen...
19551474     --------------------------------------------------------------------------------     Corynebacterium glu...
15807936  37 YTKPqlt-ggGKGKSVLILGGGLAGMASAYEMQKAGYD-VQILEFNGRAGGRCWTIRG-GDEYTELGgfkqtcefdrGLY 113 Deinococcus radiodu...
18266780   7 VTNP------PWTVDVVVVGAGFAGLAAARELTRQGHE-VLVFEGRDRVGGRSLTGRV-AGVPADMG----------GSF 68  Mycobacterium tuber...
15595618  20 VALGk-----DKQPTAIVVGAGLAGLSAAYELQKDGWQ-VTVLEARPQVGGRSGLATS---EWVGNQ------------K 78  Pseudomonas aerugin...
17548652   1 ----------MLTARIAIIGGGLSGLYAAALLEQHGIQdYVLLEARETFGGRILSVSAdSGVRADEH------------- 57  Ralstonia solanacearum
15610306   1 MTNP------PWTVDVVVVGAGFAGLAAARELTRQGHE-VLVFEGRDRVGGRSLTGRV-AGVPADMG----------GSF 62  Mycobacterium tuber...
17233185   1 -----------------MQHREFTGCIHTSCRLPISFI-FMFNLNRRQFLLRSTLAIAaTVSYDHVQ------------- 49  Nostoc sp. PCC 7120
13473162   1 MTDE------LERTDVVIVGAGFTGLSAALELKRAGIN-FVLLEARDRVGGRVEAVRNgLGERIDSG----------GQF 63  Mesorhizobium loti
3915397   16 LMAP------SSSCDCIIVGSGLSGLIAARNLSRVNYS-VLVIEAQERLGGRMYGEYLpSGQWIDRG----------GQW 78  Synechocystis sp. P...
16127025 129 FNPgpwriphHHRTLLHYCKQFGVALEPFIQ--FNHSGWIHSSQAFgg---------kPVRFNAAAA--DFEGNIAELLA 195 Caulobacter crescen...
16078962  49 RIPn------NHSLTLEYIKKFKLPTNVFINrtPMDIIYANGIKTR------------LQVFERAPG--ILRYPVAPNEQ 108 Bacillus subtilis
16125343 124 INHgawripyHHRSTLHYTKSFGVLLESFVN--DNDASYVYFEKGKgpl------ngkPVRKGEIAA--DVRGYTAELVA 193 Caulobacter crescen...
19551474     --------------------------------------------------------------------------------     Corynebacterium glu...
15807936 114 INPgpwripcHHHAYLHYAREFGVKLEPFIM--ENWNAYIHREGKNgq---------qPTRVRQAEArtDMQGHVAELLN 182 Deinococcus radiodu...
18266780  69 IGP-------TQDAVLALATELGIPTTPTHRdgRNVIQWRGSARSYrg--------tiPKLSLTGLI--DIGRLRWQFER 131 Mycobacterium tuber...
15595618  79 VQP-------TLNAYLDTFKLKPVPAPDFVRtpSYLIDGLYYSSSD------------LALKQPNVAadLKRFESTLDDL 139 Pseudomonas aerugin...
17548652  58 ---------------HAPS------------------------AAT---------------------------------- 64  Ralstonia solanacearum
15610306  63 IGP-------TQDAVLALATELGIPTTPTHRdgRNVIQWRGSARSYrg--------tiPKLSLTGLI--DIGRLRWQFER 125 Mycobacterium tuber...
17233185  50 ----------AQKPKSPGTLPKGLPRRKVIVvgAGISGLVAAYELT-----------------------AVGHDVTLLEA 96  Nostoc sp. PCC 7120
13473162  64 LCEd-------MPELMALARARGKTFVETYVegDFITHPSMPPKDAk-----------------------------QTYH 107 Mesorhizobium loti
3915397   79 VGP-------TQDRFLALLNEYNIERFPSPAdgLKVLLFDGKRYEFdgffqgvfqgeaPKISSDEWN--DAMVAWEKFNT 149 Synechocystis sp. P...
16127025 196 KSVNAKALDDAVTLEDRERLLEALKGWgmldkdyryaAsl---rTSSHRGFKRPGGGGVDGAPIPSDDLYSLHDVLDPQV 272 Caulobacter crescen...
16078962 109 GKTSEELMLSLLQPILNFINQNPARNWr---------Ive---eQYKNHSLSSFLNTYFSYGAIDMIGVLLDMEAYMGMS 176 Bacillus subtilis
16125343 194 KAASAGALDAPLSGVDRERFVAYLVNEgr------lsKsdltykGTEGRGFSVHPGAGVNPGPGKELEPFAFKDVLDSNA 267 Caulobacter crescen...
19551474   1 -----------------------------------------------------------------------MPTASPIYD 9   Corynebacterium glu...
15807936 183 KAASQGNLDTGLTTEDKEKLLEALHEWgflnkdgryvKsl---eTSTFRGYDRDPGARLEPG-TPSQPIG-LDTLLERRL 257 Deinococcus radiodu...
18266780 132 IARGVPVAAPWDARRARELDDVSLGEWlr------lvRa-----TSSSRNL-MAIMTRVTWG-CEPDDVSMLHAARYVRA 198 Mycobacterium tuber...
15595618 140 SASISDPLNPASSNTLFALDQMNAARW--------------------LDKLNLSPTARLLVNQRIRSRYDEPSRLSLLYL 199 Pseudomonas aerugin...
17548652  65 ---ER--YDLGAT-----------WLWp---------------------ALHADLAQVVETLGLETFEQFETGDMLLERS 107 Ralstonia solanacearum
15610306 126 IARGVPVAAPWDARRARELDDVSLGEWlr------lvRa-----TSSSRNL-MAIMTRVTWG-CEPDDVSMLHAARYVRA 192 Mycobacterium tuber...
17233185  97 SKRIGGRVLTLRGAFQGEDLLELGAARi--------pSn-----HHLTFGYIKHFGLKLSQFAPADGKYLTIKDGKRLLI 163 Nostoc sp. PCC 7120
13473162 108 GAMAIRERMNGIEPDDPSIKGMSVAAW--------------------LERQPDPIDARTAFRSMIEGLWCLPMDRVPLWY 167 Mesorhizobium loti
3915397  150 LAQSLDEQHPEATPENKKLDSQTFADWik------enTh----tAFGHWYFSYMCRAVGFLGPAEPSQVSLLHILWGHKS 219 Synechocystis sp. P...
16127025 273 WTSMGFFMNHEMQTTMFQPV-GGMDMIGKAFAKQVEGLITYN-AKVSKIAQDDKGVVVTYADtvtgkVTEAKGDWCVCTI 350 Caulobacter crescen...
16078962 177 LVEVLRESIFFSSPAHFYEItGGMDLLPHAFLPQLKTNILYH-QKMMKMSQGENRVTIHCQHqqtaeFTSFTADLAIVTI 255 Bacillus subtilis
16125343 268 WRVLSSVTGYEQQRTMLQPI-GGMDQIAKAFEKRVAPMIRYS-TVVQKIKQSPTGVTVSFKGpd-gkLGEVTADYCVCTI 344 Caulobacter crescen...
19551474  10 VVVVGAGISGLIATQLLDRA-GLNIKCFEACSRVGGRAVSVQ-QSDLFLDLGATWFWLNEPL-----VQQLVNNLGLGTF 82  Corynebacterium glu...
15807936 258 WSDLNQGMWYEFRSTMFEPV-GGMDAMARAFESRVGRFIKYR-ARVTEIKQDTDKVTATYVDad-gtTKTASGDYCICTI 334 Deinococcus radiodu...
18266780 199 AGGLDRLLDVKNGAQQDRVP-GGTQQIAQAAAAQLGARVLLN-AAVRRIDRHGAGVTVTSDQ------GQAEAGFVIVAI 270 Mycobacterium tuber...
15595618 200 AQQGRAYRGVDDRDLRAARLpGGSQVLAEAFVKQIKTIKTKS--KVSSIVQAKDGVAVKAGS------ETYKADYVVLAV 271 Pseudomonas aerugin...
17548652 108 RSSAPTRVKGDRSSPPALRLvGGMGAFTDAIRDRLTTECLVCgHRVRRLRHLGDCIELEADDalgsmMCHRVGHVLLAVP 187 Ralstonia solanacearum
15610306 193 AGGLDRLLDVKNGAQQDRVP-GGTQQIAQAAAAQLGARVLLN-AAVRRIDRHGAGVTVTSDQ------GQAEAGFVIVAI 264 Mycobacterium tuber...
17233185 164 PAKVLFQNQPQIRPQEIQKLtDGFDLLPKAFAQALTKEIKLD-EPVARIVQTSNGVEVSCLS-----GQRYLGDYVLCTV 237 Nostoc sp. PCC 7120
13473162 168 LIDNDRRITNEVPELQYSLR-ETMQSLAEDISGDLGDRVRLG-EPATRVEHRPQGVRVVTGK------GAMEARQLLVAL 239 Mesorhizobium loti
3915397  220 AS---QGENPE--AELLH---GGAGQIPQKIAAELGNSILLG-EPVIHIAQDDKGVEVTTTT------GKYQGKFAIVAT 284 Synechocystis sp. P...
16127025 351 PLGILGQMDLA---VTDEMMAAIKA-VPYSGQVKMGLEMNRRFWEEDDdIYGGHSFTDQE-IGLISYPNNnLFQDGPAVL 425 Caulobacter crescen...
16078962 256 PFSTLRFVKVEpyhSFSYYKRRAIReLNYISATKIGIEFKSRFWEKAG-QHGGKSITDLP-IRFSYYPSRnIGANGHAVI 333 Bacillus subtilis
16125343 345 PLSVLKQIDLD---ASAPFKAAMEG-VAYAPVNKIGLQMKSRFWEDRHhIYGGHIYTDLAgIGSISLPSY-GWQAQKGVL 419 Caulobacter crescen...
19551474  83 PQAIEGDALFEt-lVDAPSRLRGNP-IDAASGRFQAGASSLALGLAAQlKPGVLELGDPV----HSLSEE----DGEIVV 152 Corynebacterium glu...
15807936 335 PLSILSQIKLTg--VDKDLAEAIKK-VPYASSFKAGVQYKRRFWEQDDdIYGGISYTDLP-NQLISYPSNnYFSTGKGVV 410 Deinococcus radiodu...
18266780 271 PPAHRVAIEFDp-pLPPEYQQLAHH-WPQGRLSKAYAAYSTPFWRASG--YSGQALSDEA-PVFITFDVS-PHADGPGIL 344 Mycobacterium tuber...
15595618 272 PLKALGQIQMTp-sLSGTQMSALKG-TNYGWRDQILLKFKRPVWDDKS-RLSGEIFSDQG-LGMIWVEPA--LKGGANVL 345 Pseudomonas aerugin...
17548652 188 PRLAATTIGFApmlPETTMRRWQDCgTWMAPHAKYVAVFSKPFWREQR--LSGEARSSVGpLAEIHDASAr---EGGAAL 262 Ralstonia solanacearum
15610306 265 PPAHRVAIEFDp-pLPPEYQQLAHH-WPQGRLSKAYAAYSTPFWRASG--YSGQALSDEA-PVFITFDVS-PHADGPGIL 338 Mycobacterium tuber...
17233185 238 PLTVLNQITFSp-eLSEEKKQAAAGgYNYRAATRGFVKFPNRFWEREN--LNGWGFFDDEeLWHTTWDRP----EKTGIL 310 Nostoc sp. PCC 7120
13473162 240 PPATAAKLDFAp-tLPARLAKALGV-WESGAVIKILVRYPRPFWREQG--LSGMVMWRDLpGLFACDASKdAEHAALVVF 315 Mesorhizobium loti
3915397  285 PPHLAGRITYSp-pMPPLRQQLTQR-VPMGTCCKLLISYDRPFWREKG--LAGIGLGNTT-WIELCADSS-DPTTGVGVI 358 Synechocystis sp. P...
16127025 426 LGAFARDLGAFRLAGMTPEQRIEVALAQGSVIHPKSYRKEFRTGASVAWSRVPWTLG-C--CARWNEETRKQHYQTLVAM 502 Caulobacter crescen...
16078962 334 LASYTWADEALIWDSLSEGERIQYTLLNLSEIYGDIVWSEFVSGTSFSWSQYPYSAG-G--FTAFEPGQELELYPYIPVP 410 Bacillus subtilis
16125343 420 LGYYAFGGEAARISAKSPADRAAFAVAGGQKVFP-EYAENFENAFSFSWHLAEHNLG-G--WAEWGENGRKEAYPILCEP 495 Caulobacter crescen...
19551474 153 KSSKQIVRAKHVIIAVPPALAAELIGFTLDLPADVRKAAHPQHIAVMNWAKEKYTLP----TQAASAGGFGHELFQQPLG 228 Corynebacterium glu...
15807936 411 LGAYMFGTDAVVMSGMSPEERLKKVVEYNAQLHP-AAAKEFDNGVTVGWHRVPWTLG-C--YGLYNADTRERYYPTLCAR 486 Deinococcus radiodu...
18266780 345 MG----FVDARGFDSLPIEERRRDALRCFASLFGDEALDPLDY-VDYRWGTEEFAPGgP--TAAVPPGSWTKYGHWLREP 417 Mycobacterium tuber...
15595618 346 IN--LSGDNARVLQAFGDRQMVDQVLIRMNKFYP-KMRGAFAGYEIRRYSADPGTGGs---YLAYGPGQVTRFWRIWEQP 419 Pseudomonas aerugin...
17548652 263 FG--FLGVPAQVRSRTPETILLSHCRAQLVRLFGERAGTPKAE-FLKDWTSDPCTAVtAdqNPALHDGVMLPSEAPSGVW 339 Ralstonia solanacearum
15610306 339 MG----FVDARGFDSLPIEERRRDALRCFASLFGDEALDPLDY-VDYRWGTEEFAPGgP--TAAVPPGSWTKYGHWLREP 411 Mycobacterium tuber...
17233185 311 HAYLK-GEKGLEIDGFEGKTQQQKLLQHWEKILPGVSNYSVRS-YFHSWTKDIWSKG-G--WAYPTDEQEKKLFPELGKS 385 Nostoc sp. PCC 7120
13473162 316 VG----GPLALRWRVLDEAGLRAEVTGRLQEALGPDAGDIIDF-SSRDWIKDRWSGGaY--SDLIVDVTARDAERTILSG 388 Mesorhizobium loti
3915397  359 AS-FVVGDRYGKWIAMGEAERRQGVLSDLALYFGEEALSPETY-DEVDWPSEQWVGGgY--AAFMPPGVWTSFGQALSAP 434 Synechocystis sp. P...
16127025 503 DRRIVLAG-EHASYVGCWMEGALLSSLDAITRLHKRALSA 541 Caulobacter crescentus CB15
16078962 411 EGRVHFAG-EHASLTHAWMQGAIESGIRVAYEVNRLP--- 446 Bacillus subtilis
16125343 496 DGRLYLAG-EHLSYLGGWQAGAIESAWQQIAKIHARVQQA 534 Caulobacter crescentus CB15
19551474 229 HGRIHWAStEVATEFGGHLEGAVRAGIQAALQTGFNLKS- 267 Corynebacterium glutamicum ATCC 13032
15807936 487 HGRMMLAG-EHTSYWNGWQEGALLAATTAVQEMHKFASSQ 525 Deinococcus radiodurans
18266780 418 VGPIHWAStETADEWTGYFDGAVRSGQRAAAEVAALL--- 454 Mycobacterium tuberculosis
15595618 420 LSRVAFAGeHTDALYPGTIEGALRSGKRAASQVRDLYAGK 459 Pseudomonas aeruginosa PA01
17548652 340 RDRLTGIAsEWSPDFSGYVAGAVDAAQRGVAKLLATLSH- 378 Ralstonia solanacearum
15610306 412 VGPIHWAStETADEWTGYFDGAVRSGQRAAAEVAALL--- 448 Mycobacterium tuberculosis H37Rv
17233185 386 EGKIYFAG-EHTSKTRGWLQGALESGLKAAQEIHFAGSTA 424 Nostoc sp. PCC 7120
13473162 389 APPVHFAAsELSPSFPGYVEGAIVAGRIAARKIIAELQSP 428 Mesorhizobium loti
3915397  435 VGRIHWAGtEIAPRWAGFFDGAIRTGEAAAKAIIGLL--- 471 Synechocystis sp. PCC 6803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap