Conserved Protein Domain Family
BaeS

?
COG0642: BaeS 
Signal transduction histidine kinase [Signal transduction mechanisms]
Statistics
?
PSSM-Id: 223715
View PSSM: COG0642
Aligned: 798 rows
Threshold Bit Score: 30.8775
Threshold Setting Gi: 15837002
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 730745    191 LpIFANPSIILTDSRvygyitiimsaeglksvfndttalehstiaiiSAVYNSQGKASGYHFVFPPYGsrsdlpqkvfsi 270
gi 17231056    3 vamiivncnsfagtskaqrvdetvkarhqqdqqqlinrlqateaqyqailnaipdfifrlsrdgnflslngevanlpcpg 82
gi 17231092   13 QpIYSEAPLQLLLFVdgrpk----------------------skqqvQRIRAYLKDLQAEYNFELQIIdvgqqpyla--- 67
gi 17231256    1 -----------------------------------------------------------------------msvvenhqi 9
gi 17229172    5 ItENLFAALNIVVLErieagl---------------------fkiisNLPSWFRDFCQQKFSLGMEIS------------ 51
gi 17230647      --------------------------------------------------------------------------------
gi 17231163    1 ---------------------------------------------------------mlannnipitlrhdmssqssqsg 23
gi 16331345    7 LgNASSVPLQFLLFIddrpn----------------------sqdsvQEIGQCLTNLLDGHSHDLQILqiskhphlv--- 61
gi 16330677    1 ------------------------------------------------mgpdcktlfivddtpdnvrllanllsahgyri 32
gi 16330325  342 qslhlgtifqttvtevrhllqtdrvyiallqgnsplavvaescgpayktslnsqiaaspnpeemivktipteamvvhhpd 421
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 730745    271 kndtfissafrngkggslkQTNILSTRNTALGYSPCSFNLVNWVAIVSQPESvFLSPATKLAKIItgtviaigvfViLLT 350
gi 17231056   83 eeftgkniqnilptdvatiiqgiitktldtgtlqtceyqlptplemrdyearlvvsgtdevlaivrditerkqteAkLLL 162
gi 17231092   68 -----------ehfklvatPALIKIHPEPRQILAGSNIITQLKNLWPRWQAA-ADTYAKLQEDLQervd---dngRvAQP 132
gi 17231256   10 drilavddtrdnlilvqtilesegyeidlasdgisalqkveqsppdlilldvmmpgmdgyevtrrirnnpalsyipilli 89
gi 17229172   52 -------------------ILQEEFYFLENFLFDAEEFWSTSNCKNLTSGIWiQIDPQGKEYQFEahatf-vedkKiLLI 111
gi 17230647    1 ----------mismefstpTEYVFGYLYTGPILLANHWFGRIATLLTTFIAV-FLTILNLGFPNNevirfptvasRmIAC 69
gi 17231163   24 kilvvddspdnvfliktileeegytvstaengisalaelqaspcdlvlldlmmpgmdgyevtrrvrgemklpqyipilli 103
gi 16331345   62 -----------ehfrlvatPSLIKLQPEPRQVLAGSNIIQQLQKWWPRWQQ-------ELAMDPNped-----tgQsPSC 118
gi 16330677   33 rkalnanfalksieqsppdlilldvnmptmngyemcarlksnphtqeipiifisaldnvldkvkafnlggadyitkpfqm 112
gi 16330325  422 qlpkgdplrrsflryqvksllaiplatldgrlgmivvhhcqqprhwqkaEVR-LLEQLATQVAIA--------------I 486
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 730745    351 lplahwavQPIVRLQKATELITEGRGLRpstpRTISRa-sSFKRgfssgfaVPSSLLQFNTaeagSTTSVSGHGGSGhgs 429
gi 17231056  163 --------TYQELADLNTNLEHQVEERT----AELQQ---KMRElee-iqrIKNVVLHTVA----HDLRTSVIGNLM--- 219
gi 17231092  133 --------QSTINSVAVSAELLRLSDEI----FNLKQ---EKEKlle-qlqFKDRVIAMLV----HDLRNPLTAAAI--- 189
gi 17231256   90 tafhessvvegldvgaddfirkpfdtdellarvrsllrlkhsldeqkkmarQREDFVSRLT----HDLRTPLVAADR--- 162
gi 17229172  112 e-------VLEESYRHRQNIIQEARQRQ----LNYQQlikNNQK--------QEILIHCLI----HDIAGQLNAMVG--- 165
gi 17230647   70 --------MSLIVTGILSDRLRRSQEAI----ALTRA---KLESqee-lvrLREDFASTLT----HDLKTPLLGAIE--- 126
gi 17231163  104 tahdapnvahgldlgaddfirkpvtvdellarvrsllrlkhsmderdeiarQREDFVSRLT----HDLRTPLVAADR--- 176
gi 16331345  119 --------PREISSVGYSGELMKMSDEL----FLLKK---DKEEllq-qiqFKDQILAMLA----HDLRSPLTAASI--- 175
gi 16330677  113 eevlariehqlllqqqKHQLRAEIQERK-----RAEQ---S-----------LEVSLRVVS----HDLRNPVLGLSM--- 166
gi 16330325  487 --------QQAQLYQRVQTLNTNLEKQVgertAQLED---KMVElqd-lqqMKALFVQAIS----HDLRTSVMGLLM--- 547
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 730745    430 gaaFSAnsSMKSAinlgnekmsppeeenkipnnhtdAKISmdgslnhdllgphslrhndtdrssnRSHILTTSAnltear 509
gi 17231056  220 ---VLE--NLEIGsgewkvgsr-----enkgnsehgLEEStipnpqsplpnpqspvpnpqslisvPRSTIDRMI------ 283
gi 17231092  190 ---AIE--TLQs------------------------NYNPdigqfq-------------rlkpalVVNLLRQAR------ 221
gi 17231256  163 ---MLD--LFQQe-----------------------AFCKispe---------------------mkqAIAVMI------ 187
gi 17229172  166 ---CLS--LLEFEn----------------------LTPQ-------------------------GRNYLEVCQ------ 187
gi 17230647  127 ---TLK--AVQQe-----------------------KFGAvssa---------------------qqpVLATII------ 151
gi 17231163  177 ---MLA--LFQQg-----------------------ALGNlspq---------------------mqeVIAIMA------ 201
gi 16331345  176 ---AVD--TLEl------------------------LQHKpieeq----------------kpalRSQLLYQAR------ 204
gi 16330677  167 ---VLNn-CLKRAdp--------------------dQTELs-----------------------lPRQTLEQMA------ 193
gi 16330325  548 ---VLK--NLSTTeg--------------------eALTLp-------------------------RHLLDSLIr----- 572
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 730745    510 lpdyrrlfsdelSDLTETFNTMTDaldqhyALLEERVRARTkqleaakieaeaanEAKTVfIANISheLRTPLNGILGMT 589
gi 17231056  284 ------------QGNNRQLGMLDS------LLEIHSCEEKE---------------LTLH-PELVL--FGGLLEKIITDL 327
gi 17231092  222 ------------TQAKTIDKMIAD------LLQVGRGTDTE---------------LIII-PQKTE--IGLLCLEVLGEL 265
gi 17231256  188 ------------RSNQNLMQMVNT------LLEVYRFEAGK---------------KTLN-YESCN--LKEIAQEVVSEL 231
gi 17229172  188 ------------QQSFNQENLMRK------VLDTFSAEMIAle------------nFVVDgEEAPN--ILGCINDVVETL 235
gi 17230647  152 ------------RSHQTSLQLLET------LLDIYRNDTEG---------------LQLN-LIPVD--LTTLAEEAASTL 195
gi 17231163  202 ------------RSNINLLSMVNT------LLEVYRFEAGR---------------KTLA-FQPVD--LSQLLNEVIAEL 245
gi 16331345  205 ------------KQFKIMDRLIED------ILQASKNLNSQ---------------FQVH-GRPLA--IADLCQEVLELY 248
gi 16330677  194 ------------RSCERQLALINS------LVESQHWEQQ---------------GVPLV-LRRLD--LGTLVRDFAEEW 237
gi 16330325  573 -------------SGDRQLTLLNA------LCEEQTAECR---------------PLQLA-PQALP--LQPFLQQICHQW 615
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 730745    590 AISMEetdvnkirnslklifrsgelllhiltelltFSKNVLQrtkLEKRdfcitdvalqiksifgkvakdQRVRLSISlf 669
gi 17231056  328 QPLLR------------------------------ENQATCK---NLIPeg------------------lPLVMVDQ--- 353
gi 17231092  266 RDR-Y------------------------------TTKAQKV---ETDIpq-----------------dlPCVYADP--- 291
gi 17231256  232 TTLTN------------------------------EKGIALK------Ids-----------------sqIDNLGEKAgi 258
gi 17229172  236 KPSFT------------------------------LNNINLTladAIDPl--------------------ANWKVQGD-- 263
gi 17230647  196 IDLAA------------------------------SRRVHIS---FNYGds-----------------dwRRSLWVNg-- 223
gi 17231163  246 TPLAQ------------------------------EKNLAIN---SYLGda-----------------stPNILGVGVpp 275
gi 16331345  249 QAK-F------------------------------SKKNLTI---TYDIpk-----------------dlPNVFADE--- 274
gi 16330677  238 SLGLG------------------------------EQEVTLN---LNLGe--------------------nLPAIMGd-- 262
gi 16330325  616 RSACE------------------------------QHQVVLN---LKCDe--------------------tLSPLQGD-- 640
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 730745    670 pnlirtmvlwgdSNRIIQIVMNLVSNALKFTPvdgtvdvrmkllgeydkelsekKQYKEVYIKKGTEvtenlettdkydl 749
gi 17231056  354 -------------ARFEKVVMSLFSYSLQHNPpg---------------------lKFTVKttv---------------- 383
gi 17231092  292 -------------ERIRQVLINLLDNAIKYTPeg---------------------gTISIAglhr--------------- 322
gi 17231256  259 v--------mgdTLELRRVLYNLVANAIKFTDt----------------------gGIEIRffep--------------- 293
gi 17229172  264 ------------KSRLDRVIFNILENAVRYSPp---------------------ESTVIIRLQSKEN------------- 297
gi 17230647  224 -----------dPLQLQRVLYNLLVNAINHSRrg---------------------dRVEVVlet---------------- 255
gi 17231163  276 t--------vgdRLELHRLFTNLIGNAIKFTAs----------------------gSVTIRLKALILnakqdfsdl---- 321
gi 16331345  275 -------------ELIRQVIANLLDNAIKYTPah---------------------gSITVGalhr--------------- 305
gi 16330677  263 ------------ANFIWRVLENLLANSLKYNPlpr-----------------pqPLSITITVTAIDQt------------ 301
gi 16330325  641 ------------PHYIKQVFDNLLGNALNHNPp---------------------GITLTLAAQLEGN------------- 674
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 730745    750 ptlsnhrksvdlessatslgsnrdtstiqeeitkrntvaneSIYKKVNDRekasnddvssIVSTTTSSyDNAIFNSQFNK 829
gi 17231056  384 --------------------------------------edgMIRTLIQDN----------GVAISKSE-CDRLFDLQIRD 414
gi 17231092  323 --------------------------------------ttqKVQFSIGDT----------GPGIPSDN-RERIFENHYRL 353
gi 17231256  294 --------------------------------------nnhWLTIEIEDT----------GYGIAPED-QVTIFERFRQG 324
gi 17229172  298 -----------------------------------------YIYVSVDDE----------GSGVPLET-VNTLFQKFSQG 325
gi 17230647  256 --------------------------------------qasYQVVKISDT----------GAGIQAEQ-FPHLFERFYQG 286
gi 17231163  322 ---------------------------------slpssnidYIQVEIADT----------GAGIPLEE-HATLFERFRQG 357
gi 16331345  306 --------------------------------------ttqKVQVSITDN----------GPGIPNSK-QETIFEGHFRL 336
gi 16330677  302 ------------------------------------------LTCRVKDN----------GVGVDLAI-ADRVFERYQRG 328
gi 16330325  675 -----------------------------------------MVRFTLSDN----------GKGMAKDQ-CEHLFRLYLRN 702
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 730745    830 APGSDdeeggnlgrpienpktwvisievedtGPGIDPSLQESvFHPFVQGDqTLSRQYGgtglglsicrqlanmMHGtMK 909
gi 17231056  415 PQAPCs------------------------tAICLKMYLCQQ-FIQAHGGK-IGATSNp---------------RQG-LT 452
gi 17231092  354 ERDEAk------------------------eGYGIGLSLCQR-IIRAHYGQ-IWVDSNp---------------HGG-AW 391
gi 17231256  325 RNKRs--------------------------GSGLGLHLSSR-IVEAHEGM-ISLVSEv---------------GKG-SK 360
gi 17229172  326 KDKSSg-------------------------KSGLGLYFCRIt-VERWGGS-IGYAPRS----------------EGgSC 362
gi 17230647  287 HSERQa------------------------kGSGLGLYLSRQ-IIAAHNGI-IWAENRv---------------PTG-AM 324
gi 17231163  358 SHKIs--------------------------GSGLGLYLSRR-IVEAHHGK-IVVNSEl---------------GKG-SV 393
gi 16331345  337 QRDEQt------------------------dGYGLGLSLCRK-IIQAHYGQ-IWVDSRp---------------KQG-SS 374
gi 16330677  329 DRENNp------------------------lGLGLGLYVCKL-IVEAHGGQ-IGLNTAV---------------SRG-AE 366
gi 16330325  703 RHNQRl------------------------tGIGLGCYQSRQ-IVEAHGGH-IGVTSSP---------------GQG-SH 740
                        730       740
                 ....*....|....*....|....
gi 730745    910 leskvgvgskFTFTLPLNQTKEIS 933
gi 17231056  453 ----------FWFTLPSSS----- 461
gi 17231092  392 ----------FHFTLPVYPS---- 401
gi 17231256  361 ----------FTVKLPKNI----- 369
gi 17229172  363 ----------FWFCLPRFLS---- 372
gi 17230647  325 ----------FAFKLPFLPFQPSL 338
gi 17231163  394 ----------FVVSLPIQIVGKAD 407
gi 16331345  375 ----------FHFTLPVYR----- 383
gi 16330677  367 ----------IYFTLPLEKDCA-- 378
gi 16330325  741 ----------FWFTLPLAV----- 749
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap