Conserved Protein Domain Family
SPS1

?
COG0515: SPS1 
Serine/threonine protein kinase [Signal transduction mechanisms]
Statistics
?
PSSM-Id: 223589
View PSSM: COG0515
Aligned: 407 rows
Threshold Bit Score: 30.8656
Threshold Setting Gi: 20138772
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1170646   314 RelcqdaidinpsemvpdlyhslstfpqdngnnnnnnnnnNNNNNALLdqfPIQK-DTVSLNSYFqfsprtnhniqnvts 392
gi 19115650      --------------------------------------------------------------------------------
gi 19112783      --------------------------------------------------------------------------------
gi 15899886      --------------------------------------------------------------------------------
gi 6320179       --------------------------------------------------------------------------------
gi 6320489       --------------------------------------------------------------------------------
gi 6322333       --------------------------------------------------------------------------------
gi 462451    162 EreivimklishtnvmalfevwenkselylvleyvdggelFDYLVSKGklpEREA-IHYFKQIVEgvsychsfnichrdl 240
gi 16120921   24 Sg--------------------------------------SMKDVYFSp--DKSYvVAFYKKPQNdqa------------ 51
gi 16330408      --------------------------------------------------------------------------------
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1170646   393 wqsrfflnddqdpglallihdtldlarkkvdavlrldnamtyslkiknevnnyvvqlireqieinkhailthpmnlrsss 472
gi 19115650      --------------------------------------------------------------------------------
gi 19112783      --------------------------------------------------------------------------------
gi 15899886      --------------------------------------------------------------------------------
gi 6320179       --------------------------------------------------------------------------------
gi 6320489       --------------------------------------------------------------------------------
gi 6322333       --------------------------------------------------------------------------------
gi 462451    241 kpenllldkknrrikiadfgmaalelpnkllktscgsphyas--------------peivmgrpyhggpsdvwscgivlf 306
gi 16120921      --------------------------------------------------------------------------------
gi 16330408      --------------------------------------------------------------------------------
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1170646   473 ifhsplpqihsqqpeaenliyssstplqvqhdQCASFEAPSKSHLEPIpfpvssieetptandirhpsplprscsntvmk 552
gi 19115650      --------------------------------------------------------------------------------
gi 19112783      --------------------------------------------------------------------------------
gi 15899886      --------------------------------------------------------------------------------
gi 6320179       --------------------------------------------------------------------------------
gi 6320489       --------------------------------------------------------------------------------
gi 6322333       --------------------------------------------------------------------------------
gi 462451    307 alltghlpfnddnikklllkvqsgkyqmpsnlSSEARDLISKILVIDPekrittqeilkhplikkyddlpvnkvlrkmrk 386
gi 16120921   52 -----------------------------kerIDMITGRYRQNIFEQSgg------------------------------ 72
gi 16330408      --------------------------------------------------------------------------------
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1170646   553 lptprrkldsnglfsdaylnadiipnpsiESTISIDRDNNtnsrgssmkqygIGEATDSRTsnserpsssssrlgirsrs 632
gi 19115650      --------------------------------------------------------------------------------
gi 19112783      --------------------------------------------------------------------------------
gi 15899886      --------------------------------------------------------------------------------
gi 6320179       --------------------------------------------------------------------------------
gi 6320489       --------------------------------------------------------------------------------
gi 6322333     1 --------------------------medKFANLSLHEKT------------GKSSIQLNEqtgsdngsavkrtsstssh 42
gi 462451    387 dnmargksnsdlhllnnvspsivtlhskgEIDESILRSLQilwhg--vsrelITAKLLQKPmseeklfyslllqykqrhs 464
gi 16120921   73 ----------------------------eYWKDLFCWPTH------------VVEHNGKIGi------------------ 94
gi 16330408      --------------------------------------------------------------------------------
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1170646   633 itprqkieyshvdnddrtnemlsrdkdslqpqpsvdttiTSSTQATTTgtkTNSNNstnsvlpklmtsisltprrgspsf 712
gi 19115650      --------------------------------------------------------------------------------
gi 19112783    1 --------------------------------------mDAAKRLELCkeiQENEIealkaifmddfeelkvrnawn--v 40
gi 15899886      --------------------------------------------------------------------------------
gi 6320179       --------------------------------------------------------------------------------
gi 6320489     1 -------------------------------------msLSHLTLDQYyeiQCNELeairsiymddftdltkrkssw--d 41
gi 6322333    43 ynnin-----------adlharvkafqeqralkrsasvgSNQSEQDKG---SSQSPkhiqqivnkplpp----------- 97
gi 462451    465 islssssenkksatessvneprieyasktanntglrsenNDVKTLHSLeihSEDTStvnqnnaitgvnteinapvla--q 542
gi 16120921   95 ---------------------------------------VVPSYQNHFffkYGSKNn----------------------- 112
gi 16330408      --------------------------------------------------------------------------------
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1170646   713 gnlashsmqqtnsfklihdkSPISSPFTFSKDFLt--pEQHPSNIARtdsinn---amltsPNMPLSPLLLATNQTVKSp 787
gi 19115650    1 --------------------MLGTSTKCSKRDCNyakeNISRIMPTIglgykq---nfekkTADTQSSCKLLLVALLES- 56
gi 19112783   41 tnghvycihlcsrsansksiAKLDLCIELGRSYPyvkpVIKLQNGENvlnsqirflldkldTKAKDLLGEEMIFELASIv 120
gi 15899886      --------------------------------------------------------------------------------
gi 6320179     1 ------------------mvKETPLHSSSSTSLS----SLFRPTKLKnlsak----ifnggGNQSYSKTDDVSRSSSRSs 54
gi 6320489    42 kqpqiifeitlrsvdkepveSSITLHFAMTPMYPytapEIEFKNVQNvmdsqlqmlksefkKIHNTSRGQEIIFEITSFt 121
gi 6322333    98 -------lpvagsskvsqrmSSQVVQASSKSTLK----NVLDNQETQnit--------dvnINIDTTKITATTIGVNTGl 158
gi 462451    543 ksqfsintlsqpesdkaeaeAVTLPPAIPIFNASs--sRIFRNSYTSissrsr---rslrlSNSRLSLSASTSRETVHDn 617
gi 16120921  113 -------------------dFLGIKGREKEGKWFasanNQNKFLDp----------------RERGNILNYLKVCLLLTr 157
gi 16330408      --------------------------------------------------------------------------------
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1170646   788 tpsikdydilkpISkgay---------gsvYLARKKltgdyfaikvlrk------sdmiaknqvtnvKSERAIMmvqsdk 852
gi 19115650   57 ------------FCkhsdqtpeqskqmflyVAHSLQnsgiidfefse---------elepirnayadSLHNLLSkafr-- 113
gi 19112783  121 qdylndwqsdlsSQfaslee-----eravqLKHDREraevdlqlrlkrekdalfeeeqtlqnkiqdeLQRRSYEtpqsss 195
gi 15899886      --------------------------------------------------------------------------------
gi 6320179    55 kkntd-sdqedqIK----------------YNKPNDrrstigkspqg----------ngalskeshvVASSTLTgi---- 103
gi 6320489   122 qekldefqnvvnTQsleddrlqriketkeqLEKEERekqqetikkr------------sdeqrrideIVQRELEkrqddd 189
gi 6322333   159 patditpsvsntAS----------------ATHKAQllnp------------------------nrrAPRRPLStq---- 194
gi 462451    618 emplp--qlpksPSrysl---------srrAIHASPstksihksl-------------srkniaatvAARRTLQnsaskr 673
gi 16120921  158 -----------aVR----------------RMHAAG-------------------------------LCHSDLS------ 173
gi 16330408      --------------------------------------------------------------------------------
                        570       580       590       600       610       620       630       640
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1170646   853 pyv---arlfasfqnKDNLFLVMEYLpggdlatlikmmgylpdqwakqylteiv-------vgvndmhqngiihhdlkpe 922
gi 19115650  114 ------------stlPMSSTKDSKKSrysspdgv---------------------------------------------- 135
gi 19112783  196 kkktnskettsletlPTSIYFDCSISvrdchdslvtfnrvlplytishsnlstltlvkpeskeislqdcvfllrtvrist 275
gi 15899886      --------------------------------------------------------------------------------
gi 6320179   104 --------------sPTSAKKAPIDYspsrplpnnhnpvrtghtvphlp-----------------hsihnpinyihqgs 152
gi 6320489   190 ddllfnrttqldlqpPSEWVASGEAIvfsktikaklpnnsmfkfkavvnp--------------kpikltsdifsfskqf 255
gi 6322333   195 --------------hPTRPNVAPHKApaiintpkqslsarravklppgg-----------------mslkmptktaqqpq 243
gi 462451    674 slys--lqsiskrslNLNDLLVFDDPlpskkpasenvnksephslesdsdfeilcdqilfgnaldrileeeednekerdt 751
gi 16120921  174 ---------------YKNVLIDPEQG------------------------------------------------------ 184
gi 16330408      --------------------------------------------------------------------------------
                        650       660       670       680       690       700       710       720
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1170646   923 nllidnagHVKLTDFGLSRaglirrhkfvphksslsisstl--------pidnpannftmnnnnsnhsqlSTPDSFTSDH 994
gi 19115650  136 -laktasfLSVLSDGGYEDdvmnv-----------------------------------------kpsvnVLSNRLNHLP 173
gi 19112783  276 pywstedgKREIQELEYELeslkvirhdllasiyeyqleretr---gygwrlyvlqeyspkftlfsllqtVLTLDVETVR 352
gi 15899886      --------------------------------------------------------------------------------
gi 6320179   153 kdafhhphPVRSTAHSNIStvssaksdtpssnlsyqahm------------hpveilqkqiedkhfmdsqASTPGSVELQ 220
gi 6320489   256 lvkpyippESPLADFLMSSemmenfyyllseieldnsyfntsngkkeianlekeletvlkakhdnvnrlfGYTVERMGRN 335
gi 6322333   244 qfapspsnKKHIETLSNSKvvegkrsnpgslingvqst-------------stssstegphdtvgttprtGNSNNSSNSG 310
gi 462451    752 qrqrqndtKSSADTFTISGvstnkenegpeyptkiekn-------------qfnmsykpsenmsglssfpIFEKENTLSS 818
gi 16120921  185 --------HACIIDVDG-----------------------------------------------------LVVPGK---- 199
gi 16330408      --------------------------------------------------------------------------------
                        730       740       750       760       770       780       790       800
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1170646   995 KQynrskksslgqqyehseysst------------------snshsmtptpstntvvypsyyRGKDRSHGSSNIDLPASL 1056
gi 19115650  174 VEales-----------------------------------------------------cfpQTTLESSTFADFCEHKDG 200
gi 19112783  353 AFsnnileglaelhrlgishkslhldnvvlfhsghrtfaklmdfgftrtlrdmnashpfninSQSITNILPEGLYPPEVS 432
gi 15899886    1 ------------------------------------------------------------------MKINLLQYIAGFLG 14
gi 6320179   221 HNsssgsddtssrkkkslrltrffkkihnd-----yhdnhhhhhhhnrgstptkpklnlntnENIVESNGKALYETDNPV 295
gi 6320489   336 NAtfvwkirllteycnyyplgdliqsvgfvnlatariwmirllegleaihklgivhkcinleTVILVKDADFGSTIPKLV 415
gi 6322333   311 SSgggglfanfskyvdiksgslnfagklsl-----sskgidfsngsssritldelefldelgHGNYGNVSKVLHKPTNVI 385
gi 462451    819 SYleeqkpkraalsditnsfnkmnkqegmriekkiqreqlqkkndrpsplkpiqhqelrvnsLPNDQGKPSLSLDPRRNI 898
gi 16120921  200 ---------------------------------------------------------------FPPDVVGTPDFIAPEVV 216
gi 16330408    1 -------------------------------------------------------------------MELSLFYQDPNLI 13
                        810       820       830       840       850       860       870       880
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1170646  1057 RRSEsqlsfslldisrsstppl--------------anptnsnannimrrkslTENKSFSNDLLss-----------dAI 1111
gi 19115650  201 TGNLsfsnf---------------------------------------dsfptVQRSRYASDFEelel------lgkgGY 235
gi 19112783  433 ESS--------------------------------------------------FAAASRKTDIWcfgll-----vlqmLC 457
gi 15899886   15 FIALfygifslireyhfleikslevfvliffgffaityaftdrimiekpfaltFAVILFYLSLItplpltnkillitgGI 94
gi 6320179   296 ELLEkygipgrklgegas---------------------gsvsvvertdgklfACKMFRKPHLNnegt-------nqsQL 347
gi 6320489   416 HSTYgytvlnmlsrypnkngss--------------velspstwiapellkfnNAKPQRLTDIWqlgvl-----fiqiIS 476
gi 6322333   386 MATKevrleldeakf---------------------------rqilmelevlhKCNSPYIVDFYga----------ffIE 428
gi 462451    899 SQPVnskvesllqglkfkkepa--------------shwthergslfmsehveDEKPVKASDVSiessy----vplttVA 960
gi 16120921  217 KTSHllk--------------------------------------------edPQRILPNITTDr------------hAL 240
gi 16330408   14 -------------------------------------------------------IEFMFLQSWk------------sLE 26
                        890       900       910       920       930       940       950       960
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1170646  1112 Aatntni---------nsnnnISLSPap-----sDLALFYPddsKQNKKFFgtpdylapetiegkg----------ednk 1167
gi 19115650  236 G--------------------SVYKArnkfdgveYALKKIPlrlRSFSTSSnifresrtlarln---------------h 280
gi 19112783  458 Gahv--------------lnkFSSLKlimthvipLLPGSYQdlvRRCLMRDsrk-------------------------- 497
gi 15899886   95 Ietqlasrkgv-kgtvyiilgILTLIyfvyahfiNLSSILSligIGLSSLIivlgnrdrkvkgisyltypvgiplvvygi 173
gi 6320179   348 Any----------------skKVTTE--------FCIGSTL---HHENIVEtldmltegdtyllvm----------eyap 390
gi 6320489   477 GsdivmnfetpqefldstsmdETLYDll-----sKMLNNDPkkrLGTLELLpmkflrtn--------------------- 530
gi 6322333   429 Gav-----------------yMCMEY--------MDGGSLD---KIYDESSeiggidepqla------------------ 462
gi 462451    961 Tssrdps---------vlaesSTIQKpm-----lSLPSSFLntsMTFKNLSqiladdgddkhlsvp----------qnqs 1016
gi 16120921  241 S--------------------VLIYM--------YLFYRHP---LRGGK------------------------------- 258
gi 16330408   27 G--------------------THLKDk-------YLLET-----LLGIG------------------------------- 43
                        970       980       990      1000      1010      1020      1030      1040
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1170646  1168 qcdwwsvgcifFELLLGYPPFHAETPDavfkkilsgviqwpefkneeeerefltpeakdliekllvvdpak--------- 1238
gi 19115650  281 pnvirffsswvELLPSSEKQIEEEPLAsadetlsqsadidnfmfdmdtgllqhtyps----------------------- 337
gi 19112783  498 ---------rpSAIDLLSSHVIRLGTAvlppveqgtfsksarpsyggqq------------------------------- 537
gi 15899886  174 ngffplsinpiFIIVGLAIVLLNLLPSkgipssdydlkldqklcndiqrseckdviqiykkymvyipqhcldkvvlctin 253
gi 6320179   391 ydffnlvmsnlMTQDEVNCYFKQLCHGvnylhsmglahrdlkldncvvtkdgilklidfgsavvfqypyed--------- 461
gi 6320489   531 ---idstinrfNLVSESVNSNSLELTPgdtitvrgnggrtlsqssirrrsfnvgsrfssinpatrsryasdfeeiavlgq 607
gi 6322333   463 -fianavihglKELKEQHNIIHRDVKPtnilcsanqgtvklcdfgvsgnlvaslaktnigcqs----------------- 524
gi 462451   1017 rsvamshplrkQSAKISLTPRSNLNANlsvkrnqgspgsylsndldgisdmtfameiptntftaqaiqlmn--------- 1087
gi 16120921  259 -------------IHDMDDEVRDESLAmge-------------------------------------------------- 275
gi 16330408   44 ---------------GFGAVFLSKTVG----------------------------------------------------- 55
                       1050      1060      1070      1080      1090      1100      1110      1120
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1170646  1239 ----rlgakgiqeikdhpyfknvdwdhvydeeasfvptidnpedtdyfDLRGAELQDFGddiendnan-ilfgkhginTD 1313
gi 19115650  338 ------------------svqilfqedsvaddltpcystknstcnltdLFKKEADQDYAeshdcssttsqvdtlgklaPT 399
gi 19112783  538 --------------------------dgiidllyrksvsryetdfeelEFLGRGGFGEVvkvknridgrfyavkklvlLS 591
gi 15899886  254 qndmqnfnlvinnslarsvaeryvdkmspemlyslallssrkkellelACKKGYKKACEqtkpildmknwdpkvwvgkEI 333
gi 6320179   462 -----tivkshgivgsdpylapellkqtsydprvadvwsiaiifycmvLKRFPWKAPKKsfnsfrlft-eepededdiVR 535
gi 6320489   608 gafgqvvkarnaldsryyaikkirhteeklstilsevmllaslnhqyvVRYYAAWLEEDsmdenvfestdeesdlsesSS 687
gi 6322333   525 ------------ymaperikslnpdratytvqsdiwslglsilemalgRYPYPPETYDNifsqlsaiv-dgppprlpsDK 591
gi 462451   1088 ----ndtdnnkintspkassftkekviksaayiskekepdnsdtnyipDYTIPNTYDEKainifedap-sdegslntsSS 1162
gi 16120921  276 ----------------------------------------------raLFIEHPTDR----------------------- 286
gi 16330408   56 -----------------------------------------------------HDG------------------------ 58
                       1130      1140      1150      1160      1170      1180      1190      1200
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1170646  1314 VSELSAANLSPPLNHknilsr--------klsmsNTTNRSSNNSNSSVhdfgahtpvNKLSIASVLESVPQETGYItpng 1385
gi 19115650  400 KSASEMLLMDSFLSE-------------------REEDECSNIPSFDQqplclyiqmALCEETLEKHINRRNKHIHgvms 460
gi 19112783  592 DDKENSRILREVMTLsrlhhehvvryytawveteANDTVTEIISSDSEslsqslnmaVDFRQSSSLPADKLSSLDIhfed 671
gi 15899886  334 YNYNIVDIIGVGGTSyilkgekdgnfyalkipliNYLNNVMDLVGESSklielsnksPYIVRLYAIYADQLDVKEIlggn 413
gi 6320179   536 GPNKILRLLPRHSRTiigr-----------mlalEPKQRVLMNDVVKD---------DWLVSVPSCEVDPTSGDLVekpk 595
gi 6320489   688 DFEENDLLDQSSIFKnrtnhdldnsnwdfisgsgYPDIVFENSSRDDEnedldhdtsSTSSSESQDDTDKESKSIQnvpr 767
gi 6322333   592 FSSDAQDFVSLCLQK-------------------IPERRPTYAALTEH---------PWLVKYRNQDVHMSEYITErler 643
gi 462451   1163 ESDSRASVHRKAVSIdtmatt--------nvltpATNVRVSLYWNNNSsgipretteEILSKLRLSPENPSNTHMQkrfs 1234
gi 16120921  287 --SNAVKLNQVKPSS-------------------LPWADPQKVPYTIMg--------PYLTQLFEKAFIDGLHDP----- 332
gi 16330408   59 ---AIAKVAVKLMVWd------------------SKREKEQTQELELA---------TTLKHDRLINFVDLDH------- 101
                       1210      1220      1230      1240      1250      1260      1270      1280
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1170646  1386 tgtttt--saknspnlkNLSLAIPPHMRDRRSSKLNDSQTEFGSFNFrnlsaldkankdainrLKSEHFSEQPGVHRRTS 1463
gi 19115650  461 kglrncyillfarilegVLYLHDAMHLVHRDLKPRNIFLSSGVHSEPcsvclpnfsdednvevSNAYEPVNQRTLCVVPK 540
gi 19112783  672 dynssadeedpeasdisFQYSNTSDKEGSSDKDSSIEEASSVKTQENglnatlyiqmeyceklSLQDIIRDKIPVDEMWR 751
gi 15899886  414 peiyynkppmlvielmkGGSINDVINVKELVKSEYWKKIVFITTARIaealetihsegyvhcdVKPQNVLFNEKLPPNAR 493
gi 6320179   596 nhkhhl--vteeelnelTKQHGNKDSN----------------------------------------------------- 620
gi 6320489   768 rrnfvkpmtavkkkstlFIQMEYCENRTLYDLIHSENLNQQRDEYWRlfrqilealsyihsqgIIHRDLKPMNIFIDESR 847
gi 6322333   644 rnkilr--ergenglskNVPALHMGGL----------------------------------------------------- 668
gi 462451   1235 strgsr--dsnalgisqSLQSMFKDLEEDQDGHTSQADILESSMSYSkrrpseesvnpkqrvtMLFDEEEEESKKVGGGK 1312
gi 16120921  333 ---------------------SKRPTADEWETALVKTVDLIQPCQNt----------------ACEQKWYVFSGKTKPVC 375
gi 16330408      --------------------------------------------------------------------------------
                       1290      1300      1310      1320      1330      1340      1350      1360
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1170646  1464 SASLMGSSSDGSVStpgsnasnttsggklkihkptisgSPSTFGTFPKTFLRSDSfstrsyspersisidssTLSRKGSi 1543
gi 19115650  541 IGDFGLVLSQSDNLeegtnssaessfvgtstyaapelfSKHMRSVMNNNSSTDIYalgilffellypfntrmERASAIAn 620
gi 19112783  752 LFRQILEALAYIHSrgmmhrdlkpgnifldenrnvklgDFGLATENENYQDNNDKwknrqsadedlttgvgtALYVAPEl 831
gi 15899886  494 LAYDNLKNGKIIVKladlgsavkagekpfsytpayvsfDLVKSTAFGGVSPMADIyalgatvyklltgvtlnTNVMIEAm 573
gi 6320179       --------------------------------------------------------------------------------
gi 6320489   848 NVKIGDFGLAKNVHrsldilkldsqnlpgssdnltsaiGTAMYVATEVLDGTGHYnekidmyslgiiffemiYPFSTGMe 927
gi 6322333       --------------------------------------------------------------------------------
gi 462451   1313 IKEEHTKLDNKISEessqlvlpvvekkenanntennysKIPKPSTIKVTKDTAMEsntqthtkkpilksvqnVEVEEAPs 1392
gi 16120921  376 PYCGTAFKGKLPILnl---------------------ySSRKAGSYRPDDHRLMVwngqslyawhvnrliapNERTSEAq 434
gi 16330408      --------------------------------------------------------------------------------
                       1370      1380      1390
                 ....*....|....*....|....*....|...
gi 1170646  1544 igdnqqttanssdsptmtkFKsplspanttTVS 1576
gi 19115650  621 lkkgifphdfldsmpeeasLIrsmlsssnkRPT 653
gi 19112783  832 lsrrngvrydakvdmyslgIIlfemcmtfsTSM 864
gi 15899886  574 dkfeankdiryldnslystRNldllrkyvdKNT 606
gi 6320179       ---------------------------------
gi 6320489   928 rvnilkklrsvsiefppdfDDnkmkvekkiIRL 960
gi 6322333       ---------------------------------
gi 462451   1393 sdkknwfvklfqnfsshnnATkasknhvtnISF 1425
gi 16120921  435 kkrvgyfvfhndqwwlvneGItglmslpdkKTI 467
gi 16330408      ---------------------------------
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap