Conserved Protein Domain Family

COG0515: SPS1 (this model, PSSM-Id:223589 is obsolete and has been replaced by 440281)
Serine/threonine protein kinase [Signal transduction mechanisms]
PSSM-Id: 223589
Aligned: 407 rows
Threshold Bit Score: 42.0364
Created: 7-Oct-2002
Updated: 2-Oct-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
1170646   314 RelcqdaidinpsemvpdlyhslstfpqdngnnnnnnnnnNNNNNALLdqfPIQK-DTVSLNSYFqfsprtnhniqnvts 392  baker's yeast
19115650      --------------------------------------------------------------------------------      fission yeast
19112783      --------------------------------------------------------------------------------      fission yeast
15899886      --------------------------------------------------------------------------------      Sulfolobus solfat...
6320179       --------------------------------------------------------------------------------      baker's yeast
6320489       --------------------------------------------------------------------------------      baker's yeast
6322333       --------------------------------------------------------------------------------      baker's yeast
462451    162 EreivimklishtnvmalfevwenkselylvleyvdggelFDYLVSKGklpEREA-IHYFKQIVEgvsychsfnichrdl 240  baker's yeast
16120921   24 Sg--------------------------------------SMKDVYFSp--DKSYvVAFYKKPQNdqa------------ 51   Yersinia pestis
16330408      --------------------------------------------------------------------------------      Synechocystis sp....
1170646   393 wqsrfflnddqdpglallihdtldlarkkvdavlrldnamtyslkiknevnnyvvqlireqieinkhailthpmnlrsss 472  baker's yeast
19115650      --------------------------------------------------------------------------------      fission yeast
19112783      --------------------------------------------------------------------------------      fission yeast
15899886      --------------------------------------------------------------------------------      Sulfolobus solfat...
6320179       --------------------------------------------------------------------------------      baker's yeast
6320489       --------------------------------------------------------------------------------      baker's yeast
6322333       --------------------------------------------------------------------------------      baker's yeast
462451    241 kpenllldkknrrikiadfgmaalelpnkllktscgsphyas--------------peivmgrpyhggpsdvwscgivlf 306  baker's yeast
16120921      --------------------------------------------------------------------------------      Yersinia pestis
16330408      --------------------------------------------------------------------------------      Synechocystis sp....
1170646   473 ifhsplpqihsqqpeaenliyssstplqvqhdQCASFEAPSKSHLEPIpfpvssieetptandirhpsplprscsntvmk 552  baker's yeast
19115650      --------------------------------------------------------------------------------      fission yeast
19112783      --------------------------------------------------------------------------------      fission yeast
15899886      --------------------------------------------------------------------------------      Sulfolobus solfat...
6320179       --------------------------------------------------------------------------------      baker's yeast
6320489       --------------------------------------------------------------------------------      baker's yeast
6322333       --------------------------------------------------------------------------------      baker's yeast
462451    307 alltghlpfnddnikklllkvqsgkyqmpsnlSSEARDLISKILVIDPekrittqeilkhplikkyddlpvnkvlrkmrk 386  baker's yeast
16120921   52 -----------------------------kerIDMITGRYRQNIFEQSgg------------------------------ 72   Yersinia pestis
16330408      --------------------------------------------------------------------------------      Synechocystis sp....
1170646   553 lptprrkldsnglfsdaylnadiipnpsiESTISIDRDNNtnsrgssmkqygIGEATDSRTsnserpsssssrlgirsrs 632  baker's yeast
19115650      --------------------------------------------------------------------------------      fission yeast
19112783      --------------------------------------------------------------------------------      fission yeast
15899886      --------------------------------------------------------------------------------      Sulfolobus solfat...
6320179       --------------------------------------------------------------------------------      baker's yeast
6320489       --------------------------------------------------------------------------------      baker's yeast
6322333     1 --------------------------medKFANLSLHEKT------------GKSSIQLNEqtgsdngsavkrtsstssh 42   baker's yeast
462451    387 dnmargksnsdlhllnnvspsivtlhskgEIDESILRSLQilwhg--vsrelITAKLLQKPmseeklfyslllqykqrhs 464  baker's yeast
16120921   73 ----------------------------eYWKDLFCWPTH------------VVEHNGKIGi------------------ 94   Yersinia pestis
16330408      --------------------------------------------------------------------------------      Synechocystis sp....
1170646   633 itprqkieyshvdnddrtnemlsrdkdslqpqpsvdttiTSSTQATTTgtkTNSNNstnsvlpklmtsisltprrgspsf 712  baker's yeast
19115650      --------------------------------------------------------------------------------      fission yeast
19112783    1 --------------------------------------mDAAKRLELCkeiQENEIealkaifmddfeelkvrnawn--v 40   fission yeast
15899886      --------------------------------------------------------------------------------      Sulfolobus solfat...
6320179       --------------------------------------------------------------------------------      baker's yeast
6320489     1 -------------------------------------msLSHLTLDQYyeiQCNELeairsiymddftdltkrkssw--d 41   baker's yeast
6322333    43 ynnin-----------adlharvkafqeqralkrsasvgSNQSEQDKG---SSQSPkhiqqivnkplpp----------- 97   baker's yeast
462451    465 islssssenkksatessvneprieyasktanntglrsenNDVKTLHSLeihSEDTStvnqnnaitgvnteinapvla--q 542  baker's yeast
16120921   95 ---------------------------------------VVPSYQNHFffkYGSKNn----------------------- 112  Yersinia pestis
16330408      --------------------------------------------------------------------------------      Synechocystis sp....
1170646   713 gnlashsmqqtnsfklihdkSPISSPFTFSKDFLt--pEQHPSNIARtdsinn---amltsPNMPLSPLLLATNQTVKSp 787  baker's yeast
19115650    1 --------------------MLGTSTKCSKRDCNyakeNISRIMPTIglgykq---nfekkTADTQSSCKLLLVALLES- 56   fission yeast
19112783   41 tnghvycihlcsrsansksiAKLDLCIELGRSYPyvkpVIKLQNGENvlnsqirflldkldTKAKDLLGEEMIFELASIv 120  fission yeast
15899886      --------------------------------------------------------------------------------      Sulfolobus solfat...
6320179     1 ------------------mvKETPLHSSSSTSLS----SLFRPTKLKnlsak----ifnggGNQSYSKTDDVSRSSSRSs 54   baker's yeast
6320489    42 kqpqiifeitlrsvdkepveSSITLHFAMTPMYPytapEIEFKNVQNvmdsqlqmlksefkKIHNTSRGQEIIFEITSFt 121  baker's yeast
6322333    98 -------lpvagsskvsqrmSSQVVQASSKSTLK----NVLDNQETQnit--------dvnINIDTTKITATTIGVNTGl 158  baker's yeast
462451    543 ksqfsintlsqpesdkaeaeAVTLPPAIPIFNASs--sRIFRNSYTSissrsr---rslrlSNSRLSLSASTSRETVHDn 617  baker's yeast
16120921  113 -------------------dFLGIKGREKEGKWFasanNQNKFLDp----------------RERGNILNYLKVCLLLTr 157  Yersinia pestis
16330408      --------------------------------------------------------------------------------      Synechocystis sp....
1170646   788 tpsikdydilkpISkgay---------gsvYLARKKltgdyfaikvlrk------sdmiaknqvtnvKSERAIMmvqsdk 852  baker's yeast
19115650   57 ------------FCkhsdqtpeqskqmflyVAHSLQnsgiidfefse---------elepirnayadSLHNLLSkafr-- 113  fission yeast
19112783  121 qdylndwqsdlsSQfaslee-----eravqLKHDREraevdlqlrlkrekdalfeeeqtlqnkiqdeLQRRSYEtpqsss 195  fission yeast
15899886      --------------------------------------------------------------------------------      Sulfolobus solfat...
6320179    55 kkntd-sdqedqIK----------------YNKPNDrrstigkspqg----------ngalskeshvVASSTLTgi---- 103  baker's yeast
6320489   122 qekldefqnvvnTQsleddrlqriketkeqLEKEERekqqetikkr------------sdeqrrideIVQRELEkrqddd 189  baker's yeast
6322333   159 patditpsvsntAS----------------ATHKAQllnp------------------------nrrAPRRPLStq---- 194  baker's yeast
462451    618 emplp--qlpksPSrysl---------srrAIHASPstksihksl-------------srkniaatvAARRTLQnsaskr 673  baker's yeast
16120921  158 -----------aVR----------------RMHAAG-------------------------------LCHSDLS------ 173  Yersinia pestis
16330408      --------------------------------------------------------------------------------      Synechocystis sp....
1170646   853 pyv---arlfasfqnKDNLFLVMEYLpggdlatlikmmgylpdqwakqylteiv-------vgvndmhqngiihhdlkpe 922  baker's yeast
19115650  114 ------------stlPMSSTKDSKKSrysspdgv---------------------------------------------- 135  fission yeast
19112783  196 kkktnskettsletlPTSIYFDCSISvrdchdslvtfnrvlplytishsnlstltlvkpeskeislqdcvfllrtvrist 275  fission yeast
15899886      --------------------------------------------------------------------------------      Sulfolobus solfat...
6320179   104 --------------sPTSAKKAPIDYspsrplpnnhnpvrtghtvphlp-----------------hsihnpinyihqgs 152  baker's yeast
6320489   190 ddllfnrttqldlqpPSEWVASGEAIvfsktikaklpnnsmfkfkavvnp--------------kpikltsdifsfskqf 255  baker's yeast
6322333   195 --------------hPTRPNVAPHKApaiintpkqslsarravklppgg-----------------mslkmptktaqqpq 243  baker's yeast
462451    674 slys--lqsiskrslNLNDLLVFDDPlpskkpasenvnksephslesdsdfeilcdqilfgnaldrileeeednekerdt 751  baker's yeast
16120921  174 ---------------YKNVLIDPEQG------------------------------------------------------ 184  Yersinia pestis
16330408      --------------------------------------------------------------------------------      Synechocystis sp....
1170646   923 nllidnagHVKLTDFGLSRaglirrhkfvphksslsisstl--------pidnpannftmnnnnsnhsqlSTPDSFTSDH 994  baker's yeast
19115650  136 -laktasfLSVLSDGGYEDdvmnv-----------------------------------------kpsvnVLSNRLNHLP 173  fission yeast
19112783  276 pywstedgKREIQELEYELeslkvirhdllasiyeyqleretr---gygwrlyvlqeyspkftlfsllqtVLTLDVETVR 352  fission yeast
15899886      --------------------------------------------------------------------------------      Sulfolobus solfat...
6320179   153 kdafhhphPVRSTAHSNIStvssaksdtpssnlsyqahm------------hpveilqkqiedkhfmdsqASTPGSVELQ 220  baker's yeast
6320489   256 lvkpyippESPLADFLMSSemmenfyyllseieldnsyfntsngkkeianlekeletvlkakhdnvnrlfGYTVERMGRN 335  baker's yeast
6322333   244 qfapspsnKKHIETLSNSKvvegkrsnpgslingvqst-------------stssstegphdtvgttprtGNSNNSSNSG 310  baker's yeast
462451    752 qrqrqndtKSSADTFTISGvstnkenegpeyptkiekn-------------qfnmsykpsenmsglssfpIFEKENTLSS 818  baker's yeast
16120921  185 --------HACIIDVDG-----------------------------------------------------LVVPGK---- 199  Yersinia pestis
16330408      --------------------------------------------------------------------------------      Synechocystis sp....
1170646   995 KQynrskksslgqqyehseysst------------------snshsmtptpstntvvypsyyRGKDRSHGSSNIDLPASL 1056 baker's yeast
19115650  174 VEales-----------------------------------------------------cfpQTTLESSTFADFCEHKDG 200  fission yeast
19112783  353 AFsnnileglaelhrlgishkslhldnvvlfhsghrtfaklmdfgftrtlrdmnashpfninSQSITNILPEGLYPPEVS 432  fission yeast
15899886    1 ------------------------------------------------------------------MKINLLQYIAGFLG 14   Sulfolobus solfat...
6320179   221 HNsssgsddtssrkkkslrltrffkkihnd-----yhdnhhhhhhhnrgstptkpklnlntnENIVESNGKALYETDNPV 295  baker's yeast
6320489   336 NAtfvwkirllteycnyyplgdliqsvgfvnlatariwmirllegleaihklgivhkcinleTVILVKDADFGSTIPKLV 415  baker's yeast
6322333   311 SSgggglfanfskyvdiksgslnfagklsl-----sskgidfsngsssritldelefldelgHGNYGNVSKVLHKPTNVI 385  baker's yeast
462451    819 SYleeqkpkraalsditnsfnkmnkqegmriekkiqreqlqkkndrpsplkpiqhqelrvnsLPNDQGKPSLSLDPRRNI 898  baker's yeast
16120921  200 ---------------------------------------------------------------FPPDVVGTPDFIAPEVV 216  Yersinia pestis
16330408    1 -------------------------------------------------------------------MELSLFYQDPNLI 13   Synechocystis sp....
1170646  1057 RRSEsqlsfslldisrsstppl--------------anptnsnannimrrkslTENKSFSNDLLss-----------dAI 1111 baker's yeast
19115650  201 TGNLsfsnf---------------------------------------dsfptVQRSRYASDFEelel------lgkgGY 235  fission yeast
19112783  433 ESS--------------------------------------------------FAAASRKTDIWcfgll-----vlqmLC 457  fission yeast
15899886   15 FIALfygifslireyhfleikslevfvliffgffaityaftdrimiekpfaltFAVILFYLSLItplpltnkillitgGI 94   Sulfolobus solfat...
6320179   296 ELLEkygipgrklgegas---------------------gsvsvvertdgklfACKMFRKPHLNnegt-------nqsQL 347  baker's yeast
6320489   416 HSTYgytvlnmlsrypnkngss--------------velspstwiapellkfnNAKPQRLTDIWqlgvl-----fiqiIS 476  baker's yeast
6322333   386 MATKevrleldeakf---------------------------rqilmelevlhKCNSPYIVDFYga----------ffIE 428  baker's yeast
462451    899 SQPVnskvesllqglkfkkepa--------------shwthergslfmsehveDEKPVKASDVSiessy----vplttVA 960  baker's yeast
16120921  217 KTSHllk--------------------------------------------edPQRILPNITTDr------------hAL 240  Yersinia pestis
16330408   14 -------------------------------------------------------IEFMFLQSWk------------sLE 26   Synechocystis sp....
1170646  1112 Aatntni---------nsnnnISLSPap-----sDLALFYPddsKQNKKFFgtpdylapetiegkg----------ednk 1167 baker's yeast
19115650  236 G--------------------SVYKArnkfdgveYALKKIPlrlRSFSTSSnifresrtlarln---------------h 280  fission yeast
19112783  458 Gahv--------------lnkFSSLKlimthvipLLPGSYQdlvRRCLMRDsrk-------------------------- 497  fission yeast
15899886   95 Ietqlasrkgv-kgtvyiilgILTLIyfvyahfiNLSSILSligIGLSSLIivlgnrdrkvkgisyltypvgiplvvygi 173  Sulfolobus solfat...
6320179   348 Any----------------skKVTTE--------FCIGSTL---HHENIVEtldmltegdtyllvm----------eyap 390  baker's yeast
6320489   477 GsdivmnfetpqefldstsmdETLYDll-----sKMLNNDPkkrLGTLELLpmkflrtn--------------------- 530  baker's yeast
6322333   429 Gav-----------------yMCMEY--------MDGGSLD---KIYDESSeiggidepqla------------------ 462  baker's yeast
462451    961 Tssrdps---------vlaesSTIQKpm-----lSLPSSFLntsMTFKNLSqiladdgddkhlsvp----------qnqs 1016 baker's yeast
16120921  241 S--------------------VLIYM--------YLFYRHP---LRGGK------------------------------- 258  Yersinia pestis
16330408   27 G--------------------THLKDk-------YLLET-----LLGIG------------------------------- 43   Synechocystis sp....
1170646  1168 qcdwwsvgcifFELLLGYPPFHAETPDavfkkilsgviqwpefkneeeerefltpeakdliekllvvdpak--------- 1238 baker's yeast
19115650  281 pnvirffsswvELLPSSEKQIEEEPLAsadetlsqsadidnfmfdmdtgllqhtyps----------------------- 337  fission yeast
19112783  498 ---------rpSAIDLLSSHVIRLGTAvlppveqgtfsksarpsyggqq------------------------------- 537  fission yeast
15899886  174 ngffplsinpiFIIVGLAIVLLNLLPSkgipssdydlkldqklcndiqrseckdviqiykkymvyipqhcldkvvlctin 253  Sulfolobus solfat...
6320179   391 ydffnlvmsnlMTQDEVNCYFKQLCHGvnylhsmglahrdlkldncvvtkdgilklidfgsavvfqypyed--------- 461  baker's yeast
6320489   531 ---idstinrfNLVSESVNSNSLELTPgdtitvrgnggrtlsqssirrrsfnvgsrfssinpatrsryasdfeeiavlgq 607  baker's yeast
6322333   463 -fianavihglKELKEQHNIIHRDVKPtnilcsanqgtvklcdfgvsgnlvaslaktnigcqs----------------- 524  baker's yeast
462451   1017 rsvamshplrkQSAKISLTPRSNLNANlsvkrnqgspgsylsndldgisdmtfameiptntftaqaiqlmn--------- 1087 baker's yeast
16120921  259 -------------IHDMDDEVRDESLAmge-------------------------------------------------- 275  Yersinia pestis
16330408   44 ---------------GFGAVFLSKTVG----------------------------------------------------- 55   Synechocystis sp....
1170646  1239 ----rlgakgiqeikdhpyfknvdwdhvydeeasfvptidnpedtdyfDLRGAELQDFGddiendnan-ilfgkhginTD 1313 baker's yeast
19115650  338 ------------------svqilfqedsvaddltpcystknstcnltdLFKKEADQDYAeshdcssttsqvdtlgklaPT 399  fission yeast
19112783  538 --------------------------dgiidllyrksvsryetdfeelEFLGRGGFGEVvkvknridgrfyavkklvlLS 591  fission yeast
15899886  254 qndmqnfnlvinnslarsvaeryvdkmspemlyslallssrkkellelACKKGYKKACEqtkpildmknwdpkvwvgkEI 333  Sulfolobus solfat...
6320179   462 -----tivkshgivgsdpylapellkqtsydprvadvwsiaiifycmvLKRFPWKAPKKsfnsfrlft-eepededdiVR 535  baker's yeast
6320489   608 gafgqvvkarnaldsryyaikkirhteeklstilsevmllaslnhqyvVRYYAAWLEEDsmdenvfestdeesdlsesSS 687  baker's yeast
6322333   525 ------------ymaperikslnpdratytvqsdiwslglsilemalgRYPYPPETYDNifsqlsaiv-dgppprlpsDK 591  baker's yeast
462451   1088 ----ndtdnnkintspkassftkekviksaayiskekepdnsdtnyipDYTIPNTYDEKainifedap-sdegslntsSS 1162 baker's yeast
16120921  276 ----------------------------------------------raLFIEHPTDR----------------------- 286  Yersinia pestis
16330408   56 -----------------------------------------------------HDG------------------------ 58   Synechocystis sp....
1170646  1314 VSELSAANLSPPLNHknilsr--------klsmsNTTNRSSNNSNSSVhdfgahtpvNKLSIASVLESVPQETGYItpng 1385 baker's yeast
19115650  400 KSASEMLLMDSFLSE-------------------REEDECSNIPSFDQqplclyiqmALCEETLEKHINRRNKHIHgvms 460  fission yeast
19112783  592 DDKENSRILREVMTLsrlhhehvvryytawveteANDTVTEIISSDSEslsqslnmaVDFRQSSSLPADKLSSLDIhfed 671  fission yeast
15899886  334 YNYNIVDIIGVGGTSyilkgekdgnfyalkipliNYLNNVMDLVGESSklielsnksPYIVRLYAIYADQLDVKEIlggn 413  Sulfolobus solfat...
6320179   536 GPNKILRLLPRHSRTiigr-----------mlalEPKQRVLMNDVVKD---------DWLVSVPSCEVDPTSGDLVekpk 595  baker's yeast
6320489   688 DFEENDLLDQSSIFKnrtnhdldnsnwdfisgsgYPDIVFENSSRDDEnedldhdtsSTSSSESQDDTDKESKSIQnvpr 767  baker's yeast
6322333   592 FSSDAQDFVSLCLQK-------------------IPERRPTYAALTEH---------PWLVKYRNQDVHMSEYITErler 643  baker's yeast
462451   1163 ESDSRASVHRKAVSIdtmatt--------nvltpATNVRVSLYWNNNSsgipretteEILSKLRLSPENPSNTHMQkrfs 1234 baker's yeast
16120921  287 --SNAVKLNQVKPSS-------------------LPWADPQKVPYTIMg--------PYLTQLFEKAFIDGLHDP----- 332  Yersinia pestis
16330408   59 ---AIAKVAVKLMVWd------------------SKREKEQTQELELA---------TTLKHDRLINFVDLDH------- 101  Synechocystis sp....
1170646  1386 tgtttt--saknspnlkNLSLAIPPHMRDRRSSKLNDSQTEFGSFNFrnlsaldkankdainrLKSEHFSEQPGVHRRTS 1463 baker's yeast
19115650  461 kglrncyillfarilegVLYLHDAMHLVHRDLKPRNIFLSSGVHSEPcsvclpnfsdednvevSNAYEPVNQRTLCVVPK 540  fission yeast
19112783  672 dynssadeedpeasdisFQYSNTSDKEGSSDKDSSIEEASSVKTQENglnatlyiqmeyceklSLQDIIRDKIPVDEMWR 751  fission yeast
15899886  414 peiyynkppmlvielmkGGSINDVINVKELVKSEYWKKIVFITTARIaealetihsegyvhcdVKPQNVLFNEKLPPNAR 493  Sulfolobus solfat...
6320179   596 nhkhhl--vteeelnelTKQHGNKDSN----------------------------------------------------- 620  baker's yeast
6320489   768 rrnfvkpmtavkkkstlFIQMEYCENRTLYDLIHSENLNQQRDEYWRlfrqilealsyihsqgIIHRDLKPMNIFIDESR 847  baker's yeast
6322333   644 rnkilr--ergenglskNVPALHMGGL----------------------------------------------------- 668  baker's yeast
462451   1235 strgsr--dsnalgisqSLQSMFKDLEEDQDGHTSQADILESSMSYSkrrpseesvnpkqrvtMLFDEEEEESKKVGGGK 1312 baker's yeast
16120921  333 ---------------------SKRPTADEWETALVKTVDLIQPCQNt----------------ACEQKWYVFSGKTKPVC 375  Yersinia pestis
16330408      --------------------------------------------------------------------------------      Synechocystis sp....
1170646  1464 SASLMGSSSDGSVStpgsnasnttsggklkihkptisgSPSTFGTFPKTFLRSDSfstrsyspersisidssTLSRKGSi 1543 baker's yeast
19115650  541 IGDFGLVLSQSDNLeegtnssaessfvgtstyaapelfSKHMRSVMNNNSSTDIYalgilffellypfntrmERASAIAn 620  fission yeast
19112783  752 LFRQILEALAYIHSrgmmhrdlkpgnifldenrnvklgDFGLATENENYQDNNDKwknrqsadedlttgvgtALYVAPEl 831  fission yeast
15899886  494 LAYDNLKNGKIIVKladlgsavkagekpfsytpayvsfDLVKSTAFGGVSPMADIyalgatvyklltgvtlnTNVMIEAm 573  Sulfolobus solfat...
6320179       --------------------------------------------------------------------------------      baker's yeast
6320489   848 NVKIGDFGLAKNVHrsldilkldsqnlpgssdnltsaiGTAMYVATEVLDGTGHYnekidmyslgiiffemiYPFSTGMe 927  baker's yeast
6322333       --------------------------------------------------------------------------------      baker's yeast
462451   1313 IKEEHTKLDNKISEessqlvlpvvekkenanntennysKIPKPSTIKVTKDTAMEsntqthtkkpilksvqnVEVEEAPs 1392 baker's yeast
16120921  376 PYCGTAFKGKLPILnl---------------------ySSRKAGSYRPDDHRLMVwngqslyawhvnrliapNERTSEAq 434  Yersinia pestis
16330408      --------------------------------------------------------------------------------      Synechocystis sp....
1170646  1544 igdnqqttanssdsptmtkFKsplspanttTVS 1576 baker's yeast
19115650  621 lkkgifphdfldsmpeeasLIrsmlsssnkRPT 653  fission yeast
19112783  832 lsrrngvrydakvdmyslgIIlfemcmtfsTSM 864  fission yeast
15899886  574 dkfeankdiryldnslystRNldllrkyvdKNT 606  Sulfolobus solfataricus
6320179       ---------------------------------      baker's yeast
6320489   928 rvnilkklrsvsiefppdfDDnkmkvekkiIRL 960  baker's yeast
6322333       ---------------------------------      baker's yeast
462451   1393 sdkknwfvklfqnfsshnnATkasknhvtnISF 1425 baker's yeast
16120921  435 kkrvgyfvfhndqwwlvneGItglmslpdkKTI 467  Yersinia pestis
16330408      ---------------------------------      Synechocystis sp. PCC 6803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap