Conserved Protein Domain Family
SerA

?
COG0111: SerA 
Phosphoglycerate dehydrogenase or related dehydrogenase [Coenzyme transport and metabolism, General function prediction only]
Statistics
?
PSSM-Id: 223189
Aligned: 113 rows
Threshold Bit Score: 194.454
Threshold Setting Gi: 15596572
Created: 7-Oct-2002
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3122863   27 FTMAKVLVSDSIDQVGIDILKQV--AQVDVKTGLSEAE--IIDIVPEYDAIMLr--SATKVTEKIIQAGSQLKIIGRAGV 100 Synechocystis sp. P...
15893656   1 -MKTKALFTFHFSEDEIKNLEELg---FEIILRREKDLk-YTKELEDVEFMF----TYNPFKHFDIAKLKKLKWIQLESD 71  Clostridium acetobu...
19551320   1 -------MKIFVGFGDYPLTTK-----ALKEAGAEIV----DSLEKAEGf-----vFTQTPGTEFPLLPDGVRWVQFPNA 59  Corynebacterium glu...
21903496   1 -------MKFVMYPHLWESTTA-----VIEGGGHERV----EDIKDADf------iFFNGSAPEFPDLPENIKFVQASMA 58  Corynebacterium glu...
15806704   2 TGAMRVLVPDLPAFHALAQPGD------TFLPGAELAFysNDKGVPDGEAQGVvlwLANGATRDALLSVPGLQWVLTLTA 75  Deinococcus radiodu...
15673970   1 --MIKAIALENVWLNFSDETKAAfkKNKAYQFQFKKEEelTESDFLETEVLVG-----LPKPDLLAKYKN-LKWLQLLSA 72  Lactococcus lactis ...
17544735  14 IAVLDDYQDAVRKLDCFSLLQD-----HEVKVFNNTVKgvGQLAARVADVEAi--vLIRERTRVTRQLLDRLPKLKIISQ 86  Ralstonia solanacearum
15927436   1 ---MKVVGLNRMREVETELQQRFs--DLDFKFYKKASEi-pESDLADLDILVG---YDGGINEAFLQRCPNLKWIAWFAT 71  Staphylococcus aure...
15790444     --------------------------------------------------------------------------------     Halobacterium sp. N...
16800860   1 ---MKVLFTLDVPERLKNLQAEK-----FPDDTFYFESidHFTNLGEVDVIIT---YGSNITEEKIKKATNLKLIMVFSA 69  Listeria innocua
15893656   1 -MKTKALFTFHFSEDEIKNLEELg---FEIILRREKDLk-YTKELEDVEFMF----TYNPFKHFDIAKLKKLKWIQLESD 71  Clostridium acetobu...
19551320   1 -------MKIFVGFGDYPLTTK-----ALKEAGAEIV----DSLEKAEGf-----vFTQTPGTEFPLLPDGVRWVQFPNA 59  Corynebacterium glu...
21903496   1 -------MKFVMYPHLWESTTA-----VIEGGGHERV----EDIKDADf------iFFNGSAPEFPDLPENIKFVQASMA 58  Corynebacterium glu...
15806704   2 TGAMRVLVPDLPAFHALAQPGD------TFLPGAELAFysNDKGVPDGEAQGVvlwLANGATRDALLSVPGLQWVLTLTA 75  Deinococcus radiodu...
15673970   1 --MIKAIALENVWLNFSDETKAAfkKNKAYQFQFKKEEelTESDFLETEVLVG-----LPKPDLLAKYKN-LKWLQLLSA 72  Lactococcus lactis ...
17544735  14 IAVLDDYQDAVRKLDCFSLLQD-----HEVKVFNNTVKgvGQLAARVADVEAi--vLIRERTRVTRQLLDRLPKLKIISQ 86  Ralstonia solanacearum
15927436   1 ---MKVVGLNRMREVETELQQRFs--DLDFKFYKKASEi-pESDLADLDILVG---YDGGINEAFLQRCPNLKWIAWFAT 71  Staphylococcus aure...
15790444     --------------------------------------------------------------------------------     Halobacterium sp. N...
16800860   1 ---MKVLFTLDVPERLKNLQAEK-----FPDDTFYFESidHFTNLGEVDVIIT---YGSNITEEKIKKATNLKLIMVFSA 69  Listeria innocua
3122863  101 GVDNIDVPAATRQ------GIVVVNSPEGNTIAAAEHALAMMMALARHIPDANKSVKESKWER----------KQFIGT- 163 Synechocystis sp. P...
15893656  72 GFEQIPKEYTKNN------GIIVTNNKNGYSVPISEWIVWSILSTYKEANIFFQNKQDKKWK------------LRTSLr 133 Clostridium acetobu...
19551320  60 GLNAYFT-AGQIDd-----KRRWSNASGVYGQQVAEAAMALLLGLIHMHPTMVRADSWAPSTQi---------dQQTRW- 123 Corynebacterium glu...
21903496  59 GIDALVK-RGVVNe-----KARWANAAGLYADTVAESTIGLILAQMHMHATTRLAKSWSVRPEv---------eNNKSW- 122 Corynebacterium glu...
15806704  76 GIEHVQG--KLPQ------GAALYNAHRLHDRAVAVHVVAGMLAASRGLHRFRDAQQRGEWVRts-------lADTGLS- 139 Deinococcus radiodu...
15673970  73 GTNGYTQGANFPQ------EVVLTNATGTYGLTISEHLLTMAFVLLRKFDLYQKQQEKEIWEN------------IGQIq 134 Lactococcus lactis ...
17544735  87 TGRVSRDAGGHIDleactdKGVVVLEGKGSPVAPAELTWALVMAAQRRIPQYVASLKHGAWQQsglksttmppNFGIGR- 165 Ralstonia solanacearum
15927436  72 GVNTLPLDYIADH------GILLTNGKGVQAKQLSEYILAFILDDYKKMKLSYDNQRQHIYDS-----------KITGK- 133 Staphylococcus aure...
15790444   1 ------MDRLRER------GVAVTNAAGIHAPSIAEQVLGSVLTFARNLHEGWRRQQRREYR------------HYQAH- 55  Halobacterium sp. N...
16800860  70 GVDSLPTKIIQEQ------KIKVANVRGIHAIPMGEYALSFMLSHVKKAAFFYKMQKEEKWAS-----------EEPIT- 131 Listeria innocua
15893656  72 GFEQIPKEYTKNN------GIIVTNNKNGYSVPISEWIVWSILSTYKEANIFFQNKQDKKWK------------LRTSLr 133 Clostridium acetobu...
19551320  60 GLNAYFT-AGQIDd-----KRRWSNASGVYGQQVAEAAMALLLGLIHMHPTMVRADSWAPSTQi---------dQQTRW- 123 Corynebacterium glu...
21903496  59 GIDALVK-RGVVNe-----KARWANAAGLYADTVAESTIGLILAQMHMHATTRLAKSWSVRPEv---------eNNKSW- 122 Corynebacterium glu...
15806704  76 GIEHVQG--KLPQ------GAALYNAHRLHDRAVAVHVVAGMLAASRGLHRFRDAQQRGEWVRts-------lADTGLS- 139 Deinococcus radiodu...
15673970  73 GTNGYTQGANFPQ------EVVLTNATGTYGLTISEHLLTMAFVLLRKFDLYQKQQEKEIWEN------------IGQIq 134 Lactococcus lactis ...
17544735  87 TGRVSRDAGGHIDleactdKGVVVLEGKGSPVAPAELTWALVMAAQRRIPQYVASLKHGAWQQsglksttmppNFGIGR- 165 Ralstonia solanacearum
15927436  72 GVNTLPLDYIADH------GILLTNGKGVQAKQLSEYILAFILDDYKKMKLSYDNQRQHIYDS-----------KITGK- 133 Staphylococcus aure...
15790444   1 ------MDRLRER------GVAVTNAAGIHAPSIAEQVLGSVLTFARNLHEGWRRQQRREYR------------HYQAH- 55  Halobacterium sp. N...
16800860  70 GVDSLPTKIIQEQ------KIKVANVRGIHAIPMGEYALSFMLSHVKKAAFFYKMQKEEKWAS-----------EEPIT- 131 Listeria innocua
3122863  164 EVYKKTLGVVGLGKIGSHVAGVAKAMGMKLLAYDPFISQE-RADQIGCTLVD-LDLLFSEADFITLHIPKTPETANLINA 241 Synechocystis sp. P...
15893656 134 EIFGETVGILGTGHIAIETAKRLQAFGVNVLGLNT-TGRK-VEYFNECYAKDrVEEMIKECDVVVSLLPITDETHHFINE 211 Clostridium acetobu...
19551320 124 L-DGATVAIVGAGGIGKHLAAMLKPFGAKSLAVSR-TGTP-TQDFDATEPISnLHQVLADADHVVLCVPLTADTYHLIGK 200 Corynebacterium glu...
21903496 123 LHDNKTVAILGAGGIGVRLLEMLKPFNVKTIAVNN-SGRP-VEGADETFAMDkAEHVWAEADVFVLILPLTDATYQIVNA 200 Corynebacterium glu...
15806704 140 TLDGQKVVLWGYGHIGKIVEELLAPFGAQVYGLTS-KTEP-----------DlVDYRLAEADWVVLLLPSTERTRGIVNA 207 Deinococcus radiodu...
15673970 135 SIYGSTVLVHGLGDIGSHFAQKIQALGGHVIAVKRTVYGD-EEFADEVYAETdLDKVLPRADIIASSVPGTHETYKLFNQ 213 Lactococcus lactis ...
17544735 166 VLKGQTLGIFGYGKIGQLVAGYGRAFGMNVLVWGRENSKE-RARADGFAVAEsKDALFEQSDVLSVHLRLNDETRGIVTV 244 Ralstonia solanacearum
15927436 134 RLSGQTVLFLGTGAIATRTAKLAKAFNMNLIGLSK-SGQN-KDEFDEIYTIEsLESTLPNADIIINALPETQETIHLLKK 211 Staphylococcus aure...
15790444  56 ELGGSTVTVVGLGAIGHAVVDRLQGFDVDTIGVRYTPSKGgPTDEVIGFDDAaVHDALARTDYLVLATPLTDTTRGLIDA 135 Halobacterium sp. N...
16800860 132 ELAGKTLVVAGTGAIGAKVAEFAQAFDMEVIGINT-TGHP-VKPFSKTYAMTdLEKVAPLADFFVSVLPQTEETSGIYQL 209 Listeria innocua
15893656 134 EIFGETVGILGTGHIAIETAKRLQAFGVNVLGLNT-TGRK-VEYFNECYAKDrVEEMIKECDVVVSLLPITDETHHFINE 211 Clostridium acetobu...
19551320 124 L-DGATVAIVGAGGIGKHLAAMLKPFGAKSLAVSR-TGTP-TQDFDATEPISnLHQVLADADHVVLCVPLTADTYHLIGK 200 Corynebacterium glu...
21903496 123 LHDNKTVAILGAGGIGVRLLEMLKPFNVKTIAVNN-SGRP-VEGADETFAMDkAEHVWAEADVFVLILPLTDATYQIVNA 200 Corynebacterium glu...
15806704 140 TLDGQKVVLWGYGHIGKIVEELLAPFGAQVYGLTS-KTEP-----------DlVDYRLAEADWVVLLLPSTERTRGIVNA 207 Deinococcus radiodu...
15673970 135 SIYGSTVLVHGLGDIGSHFAQKIQALGGHVIAVKRTVYGD-EEFADEVYAETdLDKVLPRADIIASSVPGTHETYKLFNQ 213 Lactococcus lactis ...
17544735 166 VLKGQTLGIFGYGKIGQLVAGYGRAFGMNVLVWGRENSKE-RARADGFAVAEsKDALFEQSDVLSVHLRLNDETRGIVTV 244 Ralstonia solanacearum
15927436 134 RLSGQTVLFLGTGAIATRTAKLAKAFNMNLIGLSK-SGQN-KDEFDEIYTIEsLESTLPNADIIINALPETQETIHLLKK 211 Staphylococcus aure...
15790444  56 ELGGSTVTVVGLGAIGHAVVDRLQGFDVDTIGVRYTPSKGgPTDEVIGFDDAaVHDALARTDYLVLATPLTDTTRGLIDA 135 Halobacterium sp. N...
16800860 132 ELAGKTLVVAGTGAIGAKVAEFAQAFDMEVIGINT-TGHP-VKPFSKTYAMTdLEKVAPLADFFVSVLPQTEETSGIYQL 209 Listeria innocua
3122863  242 ETLAKMKPTA-RIINCSRGGIIDEEALVTAIETAQIGGAALDVFAQEPLGes-rLREFSNVILTPHLGASTEE--AQVNV 317 Synechocystis sp. P...
15893656 212 RIFLLMKNGV-VFVNASRGKVVEEEKLIKFLKNGKIRAAALDVVEEEPLSkdspLWQMNNVIITPHNSWISQN--MAKRK 288 Clostridium acetobu...
19551320 201 AELKAM-QSTaILINVARGEVVDTEALVDALDAQEISGAGLDVTDPEPLPddhpLWGRSNVIITPHVANTLTS--MDRML 277 Corynebacterium glu...
21903496 201 ETLGKM-KPSaVVVNVGRGPLINTDDLVDALNNGTIAGAALDVTDPEPLPdshpLWEMDNVVITPHTANTNER--IRALT 277 Corynebacterium glu...
15806704 208 ERLTALKPGV-WLSNQGRGDLIVTDDLLAALDSGHLGGAVLDVTDPEPLLaghpLWDRENVVITPHIASITSD--LLERG 284 Deinococcus radiodu...
15673970 214 EKFDLMKENA-IFLNVGRGTNVDLEALCDALESKKIAGAGIDVTDPEPLPkghrAWHTERLLITPHASGGYTLpeTWRRF 292 Lactococcus lactis ...
17544735 245 ADLTRM-KPTaLFVNTSRAELVEENGMVTALNRGRPGMAAIDVFETEPILqghtLLRMENCICTPHIGYVERE--SYEMY 321 Ralstonia solanacearum
15927436 212 KHFELMKDEA-LFINIGRGSIVKEALLIEVLKSKVIRHAYLDVFENEPLKpnheLYELENVTITAHITGNDYE--AKYDL 288 Staphylococcus aure...
15790444 136 AAFDTLPPES-VLVNVARGGVVDTDALVTAIRRQSIRGAALDVTDPEPLPedhpLWNFENVLLTPHNAGHTPD--YWPRL 212 Halobacterium sp. N...
16800860 210 SFFEKMKTNA-VFINIGRGSAVELETLERASKEEQIAHFYLDVLPEEPLPaesyLWQASNVTITPHVSGHSDK--YLDRS 286 Listeria innocua
15893656 212 RIFLLMKNGV-VFVNASRGKVVEEEKLIKFLKNGKIRAAALDVVEEEPLSkdspLWQMNNVIITPHNSWISQN--MAKRK 288 Clostridium acetobu...
19551320 201 AELKAM-QSTaILINVARGEVVDTEALVDALDAQEISGAGLDVTDPEPLPddhpLWGRSNVIITPHVANTLTS--MDRML 277 Corynebacterium glu...
21903496 201 ETLGKM-KPSaVVVNVGRGPLINTDDLVDALNNGTIAGAALDVTDPEPLPdshpLWEMDNVVITPHTANTNER--IRALT 277 Corynebacterium glu...
15806704 208 ERLTALKPGV-WLSNQGRGDLIVTDDLLAALDSGHLGGAVLDVTDPEPLLaghpLWDRENVVITPHIASITSD--LLERG 284 Deinococcus radiodu...
15673970 214 EKFDLMKENA-IFLNVGRGTNVDLEALCDALESKKIAGAGIDVTDPEPLPkghrAWHTERLLITPHASGGYTLpeTWRRF 292 Lactococcus lactis ...
17544735 245 ADLTRM-KPTaLFVNTSRAELVEENGMVTALNRGRPGMAAIDVFETEPILqghtLLRMENCICTPHIGYVERE--SYEMY 321 Ralstonia solanacearum
15927436 212 KHFELMKDEA-LFINIGRGSIVKEALLIEVLKSKVIRHAYLDVFENEPLKpnheLYELENVTITAHITGNDYE--AKYDL 288 Staphylococcus aure...
15790444 136 AAFDTLPPES-VLVNVARGGVVDTDALVTAIRRQSIRGAALDVTDPEPLPedhpLWNFENVLLTPHNAGHTPD--YWPRL 212 Halobacterium sp. N...
16800860 210 SFFEKMKTNA-VFINIGRGSAVELETLERASKEEQIAHFYLDVLPEEPLPaesyLWQASNVTITPHVSGHSDK--YLDRS 286 Listeria innocua
3122863  318 AVDVAEQIRDVLLGLPARSa---vNIPGLTPDVME 349 Synechocystis sp. PCC 6803
15893656 289 YKLVYENMRRYKAGEQ--------LKNIVDLQKGY 315 Clostridium acetobutylicum
19551320 278 APVVAENYRRFLAGEK--------MLTEVDIHKGY 304 Corynebacterium glutamicum ATCC 13032
21903496 278 GELTLRNIELFEAGEQ--------MATEVDVVAGY 304 Corynebacterium glutamicum
15806704 285 AAYARSFILDVLQGRT--------PEGEVAPGDAY 311 Deinococcus radiodurans
15673970 293 MKILEKNLDAYANGKELTNivdmkTGYKRNAHK-- 325 Lactococcus lactis subsp. lactis
17544735 322 FGIAFQNILDILQGNV--------DSVANPTALAP 348 Ralstonia solanacearum
15927436 289 LDIFKNNLVNFLNKNGl-------IENEVDAKKGY 316 Staphylococcus aureus subsp. aureus N315
15790444 213 ADIVAENLSRLDAGDS--------LENRVD----- 234 Halobacterium sp. NRC-1
16800860 287 FEIWFENINHLKENTK--------LRNEIDLNKGY 313 Listeria innocua
15893656 289 YKLVYENMRRYKAGEQ--------LKNIVDLQKGY 315 Clostridium acetobutylicum
19551320 278 APVVAENYRRFLAGEK--------MLTEVDIHKGY 304 Corynebacterium glutamicum ATCC 13032
21903496 278 GELTLRNIELFEAGEQ--------MATEVDVVAGY 304 Corynebacterium glutamicum
15806704 285 AAYARSFILDVLQGRT--------PEGEVAPGDAY 311 Deinococcus radiodurans
15673970 293 MKILEKNLDAYANGKELTNivdmkTGYKRNAHK-- 325 Lactococcus lactis subsp. lactis
17544735 322 FGIAFQNILDILQGNV--------DSVANPTALAP 348 Ralstonia solanacearum
15927436 289 LDIFKNNLVNFLNKNGl-------IENEVDAKKGY 316 Staphylococcus aureus subsp. aureus N315
15790444 213 ADIVAENLSRLDAGDS--------LENRVD----- 234 Halobacterium sp. NRC-1
16800860 287 FEIWFENINHLKENTK--------LRNEIDLNKGY 313 Listeria innocua
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap