Conserved Protein Domain Family
AsnS

?
COG0017: AsnS 
Aspartyl/asparaginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Statistics
?
PSSM-Id: 223096
View PSSM: COG0017
Aligned: 63 rows
Threshold Bit Score: 261.757
Threshold Setting Gi: 14590195
Created: 7-Oct-2002
Updated: 23-Jan-2015
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

COG0017 is classified as a model that may span more than one domain.
COG0017 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19075852  89 GRTYTQISDISAKNDG----QTVLLRARVYTSRLQGNkMCFFSLRQKYDT--IQALAVVNKDt-iSKQMVKwCGSISLES 161
gi 20139911   1 --MKMLVKQIY-ENAKeldkSKIKIKGWVVTSRGNKk-IQFIELNDGSSVlhLQLVLKS-EKm-dLNDIH-----FKTGS 69
gi 14520464     --------------------------------------------------------------------------------
gi 18313428     --------------------------------------------------------------------------------
gi 14590195     --------------------------------------------------------------------------------
gi 19111871   4 FQLPKTLKSLWHHPHNg---ELISINGWVRSIRKLKN-VCFAMVSDGTCQqaLQVVTS--------PEQSK---KLSYGA 68
gi 13541490     --------------------------------------------------------------------------------
gi 16082537     --------------------------------------------------------------------------------
gi 20139951   1 --MQLKIKEIFNQDYVklegQKIQIKAWVRSNRDSKk-IGFLVLNDGSSLtnLQAVYRV-DKidnYEEIAA----ARMWA 72
gi 135160    13 FYSSLTVKSLYEQVHHts-hDPISINGWIKSIRLLKR-IAFLDLQDGTSVnpLRIVIPLT-N----TDEVQfLKILKTGQ 85
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19075852 162 IVLVEGIVKKSPEiiksaTVQDAEIHISS----IYVISPIkKNlPFLVEDAGRSeeqireseenaaegdskfvrvNLDTR 237
gi 20139911  70 SIKAEGILNYTPK-----AEQSVELIVDK----ISLLAQS-DEd-FPIQTKKTT----------------------LEFL 116
gi 14520464     --------------------------------------------------------------------------------
gi 18313428   1 ---------------------------------MPIHPSVtELeKLVIDKESYKr--------------------MLEEW 27
gi 14590195     --------------------------------------------------------------------------------
gi 19111871  69 SVNIEGQLAVSKNak--lGLQQYELLAEK----IKIYGQInDD-NYPIQKKHLT----------------------TEML 119
gi 13541490   1 -----------------------------------------------------------------------meakEISDL 9
gi 16082537   1 -----------------------------------------------------------------------mesgEINTL 9
gi 20139951  73 AVVIEGVIKLTPT-----AKQPLELEVLN----AQILKQS-DEd-FLLSNNDLN----------------------LETL 119
gi 135160    86 TLSISNATWQSTPn----RKQPFELQIKNpvksIKLVGPVsEN--YPLQKKYQT----------------------LRYL 137
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19075852 238 LDNRVLDLRTPTNQAIFDIQAGICQAFREFLLSNSFNEIHTPKMSGASSEGGS--NVFKIQYFKTD-------------- 301
gi 20139911 117 RTIPHLRHRSNTIKAVMLVRSSISFFIHEYFQKNDFSLVAAPIITSNDGEGAG--ETFIVDSEdkepff---------gn 185
gi 14520464   1 -MNAVEIISR-DIYKAIDIQTKILDYMTKFFTDRGFKWLLPIMLSPITDPLWP--DPAGEGIRPAevdv----------y 66
gi 18313428  28 LKYSWRWAVNEKYKLVFKVQASILRALREFLDSKGFVEVLSPIIGPVTDPGIRgaKQASIDFYGAE-------------- 93
gi 14590195   1 -MSVIKIISR-DIYKVIDIQTRILDYMTKYFLGKGFKWLLPVMLSPITDPLWP--DPAEEGVKPLevev----------y 66
gi 19111871 120 RQIPHLRLRTAKQGEIFRLRSDSLKALRQFFSSKDFTETNPPIITSSDCEGAG--EVFTLTPQETHknksferddqkhff 197
gi 13541490  10 VYEVNSHLEKPELQRALKIESSVRSYLSDYLKGRGFIEVPPVIISVLTDPLN---HPVYD---Ptidy-----------y 72
gi 16082537  10 IEEISEHLEKPELYHALKVQSSIRSITSEFLKERGFIEVPPVIISVLTDPLN---HPVFD---Ptidy-----------y 72
gi 20139951 120 RLNAHLRPRTNLFHAIMKVRATLAFAVHEFMNQNEYSWLAAPLFTGNDAEGAG--ETFSIQKFdneef-----------f 186
gi 135160   138 RSLPTLKYRTAYLSAILRLRSFVEFQFMLYFQKNHFTKVSPPILTSNDCEGAG--ELFQVSTNTSPtassy--------f 207
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19075852 302 ---GFLSQSPQLYKQMLIAAdRERVFEIGPVFRAEDSNTYR---HMTEFTGLDLEMAFNEhYHEVMEFIEKLFLYIFKTI 375
gi 20139911 186 nvkATLGVTGQLHAEAYALG-LQKVYTFAPTFRAENSNTKK---HAAEFWMVEPEVAFFT-LKELIQMSEEMLKYVIKKV 260
gi 14520464  67 gvrMRLTHSMILHKQLAIAMgLEKIFVLSPNIRLESRRKDDg-rHSYEFTQLDFEIEGAK-MKDVMRLIEELIYGLFRKA 144
gi 18313428  94 ---YKVMSSAILYKQYMARV-LGKIYFVSPNIRLEPPDSIFtgrHLVEFYQLDLEMYKAT-YHEAMDLAEDLITYVVKYV 168
gi 14590195  67 gkkMRLTHSMILHKQLAIAMgLKKIFVLSPNIRIETRERDDg-kHAYEFTQFDFEVEGAK-MKDIISLVEELMHGLFRKA 144
gi 19111871 198 drpAFLTVSTQLHLEALALG-LSRVYTISPAFRAEQSHTSR---HLAEFWMLEAEVAFMTsLSQLTSLMEDMIKYTLNSL 273
gi 13541490  73 gykYSITKSMIFHKHILTKH-FGKIFTFSPNIRLEEEDKAEtgrHLSEFTQLDLEIRDAT-REDVMSLGEEMIVELFSKI 150
gi 16082537  73 gykYSLTKSMIFHKHLLTKH-FDRIFTFSPNIRLEEEDKVKtgrHLAEFTQLDLEMKGAS-RDEVMSLGEDMIIDLFKKI 150
gi 20139951 187 gkqTHLSVTGQLQAEAYAQA-FGNVYTFGPTFRAEKSHTNR---HLAEFWMIEPEMAFVD-LKGMQDIVEDLVKHVIKAV 261
gi 135160   208 gkpTYLTVSTQLHLEILALS-LSRCWTLSPCFRAEKSDTPR---HLSEFWMLEVEMCFVNsVNELTSFVETTIKHIIKAC 283
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19075852 376 REKYAKQV--AVVRQqyPSEDFILP----------------DADRIRFHFKDAVKLLK-----EAGYRKqlvpgqkvped 432
gi 20139911 261 LEKRRDEL--VFLDThiKPGLIQSled-----------fleSN-LEIIEYRKVIEILEk---nKVFFEEq---------- 313
gi 14520464 145 -----E----EWTG-----REFPR-----------------ARHFKVYDYKDILEEFG---------------------- 171
gi 18313428 169 KDVHGKELe-AVLGR--QLYEFKR-------------------PFKRYSHKEAVEFVN-----KLGCE------------ 209
gi 14590195 145 -----E----EWTG-----RDFPK-----------------ARHFKVYEYKDILDEFG---------------------- 171
gi 19111871 274 MEQNYHR---DHWD-----QLLKP--------------------WKCMTYSEAIEELSa---vKKTWKYp---------- 312
gi 13541490 151 KKTHSDDL--KFFG-----RDLRIP----------------KKPFERIRYKDAEKEYG---------------------- 185
gi 16082537 151 KRSNEEDL--KFFG-----RDLRIP----------------SKPFKRIAYLDAYKQYG---------------------- 185
gi 20139951 262 LEKNQQEL--EFLAQrnDENLIKKlqk-----------vveSK-FERIEYKDAVKILAdavknGHQFENn---------- 317
gi 135160   284 IDNQQELLpkQFISSqeNNASSELSinqetqqiktrwedliNEKWHNITYTNAIEILK-----KRHNEVshf-------- 350
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 19075852 433 eefhyceDPEFDDFSTPEERALGqivrEKYHTDFYVIDKYPSSVRPFYTMPDPEDPRYSNSYDFFMKG--QEIMSGAQRI 510
gi 20139911 314 ------nIEFGMDLKTEHERFIA----EKYAKGPVGVINYPKKLKAFYMYQNDDN-ETVAAFDLLVPGi-GELVGGSQRE 381
gi 14520464 172 ----------SDEK---ASMEME------E--P-FWIVNIP---REFYDREEN---GVWKNYDLILPYgyGEVSSGGERE 223
gi 18313428 210 -------NSPREELRWECEKVMS----AHHDSP-FFVYDYPRGSRGFYDREDPERPGVLRDFDMLYPEgfGEAISGAERE 277
gi 14590195 172 ----------SDEK---ASQVME------E--P-FWVINIP---REFYDREED---GVWRNYDLILPYgyGEVLSGGERE 223
gi 19111871 313 -------PKWGNDLSSEHEKYLC----EILHKTPVFVTDYPQKIKPFYMKSSGPD--TVAAVDLLVPQv-GELAGGSLRK 378
gi 13541490 186 ----------GDFE-SILSKEKK------E--P-FWIIDIPLEKREFYDREDPQRPGILVDMDLVYPEgfGEALSGGERE 245
gi 16082537 186 ----------EDFE-HILSSEMK------E--P-FWIIDIPLEKREFYDREDPSRPGILVDMDLIYPEgfGEALSGGERE 245
gi 20139951 318 ------eIFFGMDLGSEHERYMC----ETYHQGPVFLQNYPKDIKAFYMKLNDDQ-QTVASTDLLIPGv-GELVGGSQRE 385
gi 135160   351 ----kyePKWGQPLQTEHEKFLAg----EYFKSPVFVTDYPRLCKPFYMKQNSTPDDTVGCFDLLVPGm-GEIIGGSLRE 421
                       490       500       510       520       530       540       550
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 19075852 511 HDPELLVERMKALGVSPdVGLQQYIDAFAIG-CPPHAGGGIGLERVVMFYLNLP-NIRLASSFPRDPKRLLP 580
gi 20139911 382 NRYEKLEQRIQELNIDQ-KDIQWYLDLRKYG-YSGSAGFGLGLERLVMYITGID-NIRDSIPFPRTPNNLKM 450
gi 14520464 224 WEYEKIVAKIRAAGLKE-DSFRPYLEIARAGkLKPSAGAGIGVERLVRFIVGAK-HIAEVQPFPRVPGIPAV 293
gi 18313428 278 FEPERLVERIREGGEDP-AKYQWFLQMAKELyPLQTAGFGIGVERLTRYICGLR-AVWEARPYPKVAGIIGG 347
gi 14590195 224 WEYQKIIEKIRASGLSE-ESFKPYLEIARAGkLKPSAGAGIGVERLVRFIVSAH-HVSEVQLFPRIPGIPAM 293
gi 19111871 379 DHLD-------EYKTYP-PELQWYLDLMKYS-NAPHGGFGLGIERLIAFLEGENtNVKETIPFPRSVGSIFA 441
gi 13541490 246 YKLDRIIERIHKKRQTE-EQFKWYIEFAKDG-LYPSAGFGIGIERLTRYICGLS-RIEDVHPFPKVPGKLSL 314
gi 16082537 246 YELSRIIDRIHRKGQTE-EQFKWYIEFAKEG-LMPSAGFGIGIERLTRFICGLE-RIEDAHPFPKIPGHLSL 314
gi 20139951 386 DSYEKLLKRCQELKMPI-ESLQWYLDLRRFG-YYMSSGFGIGFERLVMYVTGVN-NIKDTIPFPRSHGQIEF 454
gi 135160   422 DDYDKLCREMKARGMNRsGELDWYVSLRKEG-SAPHGGFGLGFERFISYLYGNH-NIKDAIPFYRTSAESID 491
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap