Conserved Protein Domain Family
PHA03103

?
PHA03103: PHA03103 
double-strand RNA-binding protein; Provisional
Statistics
?
PSSM-Id: 222987
View PSSM: PHA03103
Aligned: 18 rows
Threshold Bit Score: 196.906
Threshold Setting Gi: 9633665
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

PHA03103 is classified as a model that may span more than one domain.
PHA03103 is not assigned to any domain superfamily.
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 211956314   7 GCNYSDMEITKLVKDIITNLPLGRHITALEIARQLNVEKSYINRQLYKLYHEGLLNVIPTNPPRWFKKTCTKEEEDVmsv 86
gi 148912911   1 MYSFDEVDSYELVKKMVNNLSESEFITAIEISKKLNIEKSNVNKQLYKLHNDGFIFMIRSNPPKWFKKNGIDNNDND--- 77
gi 157939656   5 SCTVNDAEIFSLVKKEVLSLNTNDYTTAISLSNKLKIDKKKINQQLYKLKKEDTVKMVPSNPPKWFKNYNGEHDSKL--- 81
gi 38229197    4 PGCENDVKTFSLVKNEVMMLNVDEYTTSIDISNKLKINKKKINKQLYKLQKEGVLKMVPSNPPKWFKNCNCEDSENNdn- 82
gi 62637420    7 GCNYSDMEITKLVNDIITNLPLGRHITALEIARRLNIEKSHINRQLYKLYHEGSLNVLPTNPPRWFKKPCSNNEEDIisp 86
gi 9627565     3 KIYIDERSDAEIVCEAIKNIGL-EGVTAVQLTRQLNMEKREVNKALYDLQRSAMVYSSDDIPPRWFMTTEADKPDAMtma 81
gi 12085017    5 SCTVNDAEIFSLVKKEVLSLNTNDYTTAISLSNRLKINKKKINQQLYKLQKEDTVKMVPSNPPKWFKNYNCDNGEKhds- 83
gi 18640118    2 CSDISNEDVYSLVKQEVDSLPVGNFITAVEISKKIEKEKSSINRQLYALYQQGYIDMVPACPPKWYKRNQDNMNNE---- 77
gi 15150473    1 MYSCDEVDSYELVKKMVNNLSESEFITAIEISRKLNIEKSNVNKQLYKLHNDGFIFMIRSNPPKWFKKNSIDNDDNE--- 77
gi 21492487    1 MYSCDEVDSYELVKKIVNNLSESESITAIEISKKLNIEKSNVNKQLYKLHNDGFIFMIRSNPPKWFKKNGIDNDDNE--- 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 211956314  87 ivetntyldeldiETMGKNNPELFGDTIPYEKILAWKDKNPCSVLNEYCQYTSRDWYIDIISSGPIHKPLFTATLCISGV 166
gi 148912911  78 -------------NNDTKKLNKSFSDTIPYYKIVLWKEKNPCSAINEYCQFTSRDWYINISSCGNGRKPMFLASVIISGI 144
gi 157939656  82 -------------EQKHHIPNHIFSDTVPYKKIINWKDKNPCIVLNEYCQFTCRDWSIDITTSGKSHCPMFTATVIISGI 148
gi 38229197   83 -----------klESRDHVPHHIFKDEIPYKKIISWKDKTPCTVINEYCQLTSRDWSIEVTTAGESHCPIFTASVIISGI 151
gi 62637420   87 ivetntyldeldiETMDKNNPELFGDTIPYEKILAWKDKNPCSILNEYCQYTSRDWFIDIISSGPIHKPLFTATLCISGV 166
gi 9627565    82 dvi----iddvsrEKSMREDHKSFDDVIPAKKIIDWKNANPVTIINEYCQITKRDWSFRIESVGPSNSPTFYACVDIDGR 157
gi 12085017   84 -----------klEQKNHIPNHIFSDTVPYKKIINWKDKNPCIVLNEYCQFTCRDWSIDITTSGKSHCPMFTATVIISGI 152
gi 18640118   78 -------------SIEIHNPDHMFSDTIPYTKIIEWKNKNPITVLNEYCQITQRDWIIDIISSGQSHCPIFTASITVSGI 144
gi 15150473   78 -------------NNDTKKLNKSFSDTIPYYKIVLWKEKNPCSAINEYCQFTSRDWYINISSCGNGRKPMFLASVIISGI 144
gi 21492487   78 -------------NNNTKKLNKSFSDTIPYYKIVLWKEKNPCSAINEYCQFTSRDWYINISSCGNGRKPMFLASVIISGI 144
                        170       180       190
                 ....*....|....*....|....*....|...
gi 211956314 167 KFRSAIGSTKKEAKTNATRMAMDLIINNSIIKF 199
gi 148912911 145 KFFPEIGNTKKEAKQKSTKRTIDFLINTSIIKF 177
gi 157939656 149 KFKPAIGNTKREAKYNASKITMDEILDSVIIKF 181
gi 38229197  152 KFKPEIGNTKKEAKHKASKITMEEILKSSIVKF 184
gi 62637420  167 KFRSAIGSTKKEAKTNATKMAMDLIINNSIIKF 199
gi 9627565   158 VFDKADGKSKRDAKNNAAKLAVDKLLGYVIIRF 190
gi 12085017  153 KFKPAIGNTKREAKYNASKITMDEILDSVIIKF 185
gi 18640118  145 KCKTGKGSTKKEAKQIAARETMNFILNKTIIKF 177
gi 15150473  145 KFFPEIGNTKKEAKQKSTKRTIDFLINTSIIKF 177
gi 21492487  145 KFFPEIGNTKKEAKQKSTKRTIDFLINTSIIKF 177
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap