Conserved Protein Domain Family
DUF3504

?
pfam12012: DUF3504 (this model, PSSM-Id:221377 is obsolete and has been replaced by 432262)
Domain of unknown function (DUF3504)
This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is typically between 156 to 173 amino acids in length.
Statistics
?
PSSM-Id: 221377
Aligned: 23 rows
Threshold Bit Score: -1
Created: 22-Dec-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q4SJZ1         90 GAVAaSRVAESYLWECKQ-LGAYSPIVLLNTLLFFCT---KHFGY-TTLEQHRRLSFSNFTRCSKPCSRT-GKSSYLLHR 163  spotted green...
Q6DFE3       1108 GSIF-SRVEEEYLWQLNQ-LGTQSPMSLLFSLLYFNT---KYFNL-KTVEQHLRLSFGNVFRQWKSNPLTnESKACLQYQ 1181 African clawe...
Q9BLG1        537 QPI--SIADLRKMYDTAV-LGTANPLALLRKVWFEIT---LHFCH-KGAESQEKLLKTSFQVFRDH--------NFRTYV 601  Halocynthia r...
Q4T0X5        143 QAV--TRSDLRRLYQSPV-FDPDSPCGLLNKVWFETC---MYFCT-RGRENQRELREDSFGLAADQd---gRRFVYLRAP 212  spotted green...
Q8C4P0        534 SLS-----DEEEMWQAGC-LGDDSPITLLSTVVKYNS---QYLNM-RTLQEHADLMYGDIELLKDPq----NQPYFARTD 599  house mouse
Q0P6E2        529 NIVYfSLSDEEEMWQAGC-LGDDSPITLLSTVVKYNS---QYLNM-RTLQEHADLMYGDIELLKDPq----NQPYFARTD 599  house mouse
Q6UVT7        162 NAVQ-TQLGLKDKATTHV-VTQEAVLPLIFALTEQDPg--NSLNLeKLLKTHQVAIFINHILETRNf----ESKWHSNQL 233  Pseudendoclon...
XP_001639242  390 vesItETQLE-RMWQSGA-IGVHAPRPLLRLQWWINT---VCHGI-RGRMAHHDLSIDDFRISRGADG-K-IVIDHIKAG 461  starlet sea a...
XP_001641993  212 akpltSDDIR-QLWNRGV-IGIDNPRALHRFAFMIVA---INFGI--TARIGLHLLKPSMFKFDV---DK-NSGLPYVQY 280  starlet sea a...
XP_001639277  147 PEHKsPIEPG-DMDKLRSyFDVDSPNKLQEFVWFNDDseqKYVCI-KHTEQSKNYQGGYKQKD-----QD-YSDVRMYGI 218  starlet sea a...
Q6DFE3       1108 GSIF-SRVEEEYLWQLNQ-LGTQSPMSLLFSLLYFNT---KYFNL-KTVEQHLRLSFGNVFRQWKSNPLTnESKACLQYQ 1181 African clawe...
Q9BLG1        537 QPI--SIADLRKMYDTAV-LGTANPLALLRKVWFEIT---LHFCH-KGAESQEKLLKTSFQVFRDH--------NFRTYV 601  Halocynthia r...
Q4T0X5        143 QAV--TRSDLRRLYQSPV-FDPDSPCGLLNKVWFETC---MYFCT-RGRENQRELREDSFGLAADQd---gRRFVYLRAP 212  spotted green...
Q8C4P0        534 SLS-----DEEEMWQAGC-LGDDSPITLLSTVVKYNS---QYLNM-RTLQEHADLMYGDIELLKDPq----NQPYFARTD 599  house mouse
Q0P6E2        529 NIVYfSLSDEEEMWQAGC-LGDDSPITLLSTVVKYNS---QYLNM-RTLQEHADLMYGDIELLKDPq----NQPYFARTD 599  house mouse
Q6UVT7        162 NAVQ-TQLGLKDKATTHV-VTQEAVLPLIFALTEQDPg--NSLNLeKLLKTHQVAIFINHILETRNf----ESKWHSNQL 233  Pseudendoclon...
XP_001639242  390 vesItETQLE-RMWQSGA-IGVHAPRPLLRLQWWINT---VCHGI-RGRMAHHDLSIDDFRISRGADG-K-IVIDHIKAG 461  starlet sea a...
XP_001641993  212 akpltSDDIR-QLWNRGV-IGIDNPRALHRFAFMIVA---INFGI--TARIGLHLLKPSMFKFDV---DK-NSGLPYVQY 280  starlet sea a...
XP_001639277  147 PEHKsPIEPG-DMDKLRSyFDVDSPNKLQEFVWFNDDseqKYVCI-KHTEQSKNYQGGYKQKD-----QD-YSDVRMYGI 218  starlet sea a...
Q4SJZ1        164 SSStapPRQEtgtnyRERTKnppfsfymcffglvfrtSEETADGRGAGDASERGQRApvSRQTLRVLPLQmPGVREEENR 243  spotted green...
Q6DFE3       1182 VTSlceSDSEdkiapGKRKH------------------EDEEPVFEQLENTADPSRCpvNIFDYYLSKSP-QNLNQRMDV 1242 African clawe...
Q9BLG1        602 SRTaceKSSQd--------------------------------tDEIRMYETGGELCpvQSFQLYL-----RKLHPLQSR 644  Halocynthia r...
Q4T0X5        213 GPShrpRCAL-----GTRRRp----------------DAEEEPW--PRMYETGTRLCpyASFLRYLAKRN-RSCR----A 264  spotted green...
Q8C4P0        600 SVKresRSGStrvchGKIYH----------------------------EHSRGHKQCpyCLLYKYMYIHRpPTQMEAKSP 651  house mouse
Q0P6E2        600 SVKresRSGStrvchGKIYH----------------------------EHSRGHKQCpyCLLYKYMYIHRpPTQMEAKSP 651  house mouse
Q6UVT7        234 LGAfikKANDsvvyvSSAE-------------------LKQSILLQQASKGIPPKQIakQPFV--------KTITQIKET 286  Pseudendoclon...
XP_001639242  462 --SkrpRAGSdekeiNRNK------------------KKCKA----KVTATDGGERDpvRAFEVYLRHRP-PGI----SS 512  starlet sea a...
XP_001641993  281 --NprgQGADqnkkaTKAN------------------R--------RLFGIPGSRQCpvAALKLYIQKRN----DEGTEA 328  starlet sea a...
XP_001639277  219 --P---------------------------------------------GSPLDPIAAleKMLEKLHPEC---------DA 242  starlet sea a...
Q6DFE3       1182 VTSlceSDSEdkiapGKRKH------------------EDEEPVFEQLENTADPSRCpvNIFDYYLSKSP-QNLNQRMDV 1242 African clawe...
Q9BLG1        602 SRTaceKSSQd--------------------------------tDEIRMYETGGELCpvQSFQLYL-----RKLHPLQSR 644  Halocynthia r...
Q4T0X5        213 GPShrpRCAL-----GTRRRp----------------DAEEEPW--PRMYETGTRLCpyASFLRYLAKRN-RSCR----A 264  spotted green...
Q8C4P0        600 SVKresRSGStrvchGKIYH----------------------------EHSRGHKQCpyCLLYKYMYIHRpPTQMEAKSP 651  house mouse
Q0P6E2        600 SVKresRSGStrvchGKIYH----------------------------EHSRGHKQCpyCLLYKYMYIHRpPTQMEAKSP 651  house mouse
Q6UVT7        234 LGAfikKANDsvvyvSSAE-------------------LKQSILLQQASKGIPPKQIakQPFV--------KTITQIKET 286  Pseudendoclon...
XP_001639242  462 --SkrpRAGSdekeiNRNK------------------KKCKA----KVTATDGGERDpvRAFEVYLRHRP-PGI----SS 512  starlet sea a...
XP_001641993  281 --NprgQGADqnkkaTKAN------------------R--------RLFGIPGSRQCpvAALKLYIQKRN----DEGTEA 328  starlet sea a...
XP_001639277  219 --P---------------------------------------------GSPLDPIAAleKMLEKLHPEC---------DA 242  starlet sea a...
Q4SJZ1        244 RVLPSARTERAHAQLPLVHVPAPGALHPGEHAHAHPG 280  spotted green pufferfish
Q6DFE3       1243 FYLKPESSASTDSTIWYTSSSLERNILENMLIRVLLV 1279 African clawed frog
Q9BLG1        645 LFQQPRRKSTPASPMWYGKAPIGEKALQQMMANISVS 681  Halocynthia roretzi
Q4T0X5        265 FFQRPRERSSAGDLTWYENKAIGKNLLGTRMQMLSRS 301  spotted green pufferfish
Q8C4P0        652 FYLTARKEATDMGSVWYEEQRMGLRSLRGIVPNLARK 688  house mouse
Q0P6E2        652 FYLTARKEATDMGSVWYEEQRMGLRSLRGIVPNLARK 688  house mouse
Q6UVT7        287 YSGQAKSISKLVKNLIYIINRSKTKLVSNISFGLSQK 323  Pseudendoclonium akinetum
XP_001639242  513 FYLTPKHK--PKGDVWFNKVPMGKNSIGRIMREIKAI 547  starlet sea anemone
XP_001641993  329 FFHTPNRHF-KETGVWYTPQPTGKNTLGRLMKDIAAE 364  starlet sea anemone
XP_001639277  243 LLQTPLVNFDKKGSCWYKNEPLGKNSISKLMPKISQK 279  starlet sea anemone
Q6DFE3       1243 FYLKPESSASTDSTIWYTSSSLERNILENMLIRVLLV 1279 African clawed frog
Q9BLG1        645 LFQQPRRKSTPASPMWYGKAPIGEKALQQMMANISVS 681  Halocynthia roretzi
Q4T0X5        265 FFQRPRERSSAGDLTWYENKAIGKNLLGTRMQMLSRS 301  spotted green pufferfish
Q8C4P0        652 FYLTARKEATDMGSVWYEEQRMGLRSLRGIVPNLARK 688  house mouse
Q0P6E2        652 FYLTARKEATDMGSVWYEEQRMGLRSLRGIVPNLARK 688  house mouse
Q6UVT7        287 YSGQAKSISKLVKNLIYIINRSKTKLVSNISFGLSQK 323  Pseudendoclonium akinetum
XP_001639242  513 FYLTPKHK--PKGDVWFNKVPMGKNSIGRIMREIKAI 547  starlet sea anemone
XP_001641993  329 FFHTPNRHF-KETGVWYTPQPTGKNTLGRLMKDIAAE 364  starlet sea anemone
XP_001639277  243 LLQTPLVNFDKKGSCWYKNEPLGKNSISKLMPKISQK 279  starlet sea anemone
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap