Conserved Protein Domain Family
DUF2315

?
pfam10231: DUF2315 (this model, PSSM-Id:220639 is obsolete and has been replaced by 431155)
Uncharacterized conserved protein (DUF2315)
This is a family of small conserved proteins found from worms to humans. The function is not known.
Statistics
?
PSSM-Id: 220639
Aligned: 6 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Dec-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q148E1  51 RHDWIGPPDKYSNLRPIHFYIPENESPLEQKLRELRQETQEWNQQFWADQNLTFHKEKEEFVRSRlkakgldlRTASGQK 130 cattle
A8WJ42  16 RFDWVGPPDSVSKIRKIMLRRVDNESELERQYRAAREELNQWNSDFWAEHNQLFDRQKSEFVEKK--------QKELGRL 87  Caenorhabditis briggsae
Q29I38  29 SCDYIGPPDPQSNLRPYVRHYDENETDLAKKLRLTRIEVEAWNASFWTKHNKRFYEEKEDFIRl---------HKEAG-T 98  Drosophila pseudoobscura
Q9W549  50 KCDYIGPPDAQSNLRPYVRHYGDEETRLARSLRLKRIEVEAWNTDFWTKHNKRFYEEKEDFIRl---------HKESG-T 119 fruit fly
Q86EW4  59 SRSF----QNSSNIQPLKLKSKLNETPLELKYRNVYQETWRWLDEYWSLYNLSYSKAKNAFLEKEq------mKNCGNNS 128 Schistosoma japonicum
Q4S6F9  69 THDWIGPPNPLSNLRPIVYHIPENETELEKRLRHLRQDTEDWNQEFWANQNITFSQEKEAFIISHlkakglglRDEQGRR 148 spotted green pufferfish
A8WJ42  16 RFDWVGPPDSVSKIRKIMLRRVDNESELERQYRAAREELNQWNSDFWAEHNQLFDRQKSEFVEKK--------QKELGRL 87  Caenorhabditis briggsae
Q29I38  29 SCDYIGPPDPQSNLRPYVRHYDENETDLAKKLRLTRIEVEAWNASFWTKHNKRFYEEKEDFIRl---------HKEAG-T 98  Drosophila pseudoobscura
Q9W549  50 KCDYIGPPDAQSNLRPYVRHYGDEETRLARSLRLKRIEVEAWNTDFWTKHNKRFYEEKEDFIRl---------HKESG-T 119 fruit fly
Q86EW4  59 SRSF----QNSSNIQPLKLKSKLNETPLELKYRNVYQETWRWLDEYWSLYNLSYSKAKNAFLEKEq------mKNCGNNS 128 Schistosoma japonicum
Q4S6F9  69 THDWIGPPNPLSNLRPIVYHIPENETELEKRLRHLRQDTEDWNQEFWANQNITFSQEKEAFIISHlkakglglRDEQGRR 148 spotted green pufferfish
Q148E1 131 ATLNAEEMAEFYKEFLSKNFQKHMYYNRDWYKRNFAITFFMGKVALERIWNKL 183 cattle
A8WJ42  88 EHVSANELSEFYRDFLNDRHVAMMVYNKEWYRRNLQLIWPALKVNVVRFFRMA 140 Caenorhabditis briggsae
Q29I38  99 EDISADRMSEFYKTFLDKNWRIHMMYNLSWYLKNFDMLTLAFMVQVQKLLTRR 151 Drosophila pseudoobscura
Q9W549 120 SEVSADQMSHFYKAFLDKNWRIHIMYNISWYLKNFDILTLAAAVQLQRLLALA 172 fruit fly
Q86EW4 129 NEVKVPDIGVFHREFLDANKKQRIQFNLKWYRSIAYVVYLGILVDLQRLYRAL 181 Schistosoma japonicum
Q4S6F9 149 RTLNSEEMAVFYKSFLDKNRTRHAKYNREWYRRNLNITLLMARVTLSSVWRRV 201 spotted green pufferfish
A8WJ42  88 EHVSANELSEFYRDFLNDRHVAMMVYNKEWYRRNLQLIWPALKVNVVRFFRMA 140 Caenorhabditis briggsae
Q29I38  99 EDISADRMSEFYKTFLDKNWRIHMMYNLSWYLKNFDMLTLAFMVQVQKLLTRR 151 Drosophila pseudoobscura
Q9W549 120 SEVSADQMSHFYKAFLDKNWRIHIMYNISWYLKNFDILTLAAAVQLQRLLALA 172 fruit fly
Q86EW4 129 NEVKVPDIGVFHREFLDANKKQRIQFNLKWYRSIAYVVYLGILVDLQRLYRAL 181 Schistosoma japonicum
Q4S6F9 149 RTLNSEEMAVFYKSFLDKNRTRHAKYNREWYRRNLNITLLMARVTLSSVWRRV 201 spotted green pufferfish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap