Conserved Protein Domain Family
LETM1

?
pfam07766: LETM1 (this model, PSSM-Id:219562 is obsolete and has been replaced by 336805)
LETM1-like protein
Members of this family are inner mitochondrial membrane proteins which play a role in potassium and hydrogen ion exchange. Deletion of LETM1 is thought to be involved in the development of Wolf-Hirschhorn syndrome in humans.
Statistics
?
PSSM-Id: 219562
View PSSM: pfam07766
Aligned: 13 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Dec-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62510850   80 KETLMVKVKHALKHYANGTKLLGYEIK--VSTKLLIKFAQGYE----LSRRERNQLRRTMGDVFRLI-PFSAFLIIPFAE 152
gi 75028718   88 KPPLKDRIIHELKHYYHGFRLLALETR--VSAKYLWTVLRGAT----LSRRERQQLVRTVSDLFRLV-PFSFFIIVPFME 160
gi 74801714   62 KKTLKQRIWAELVHYYHGFRLLFIDIN--ISRKLLWRVLNGKT----LTRREHKLLIRTTSDLFRLV-PFSVFIIVPFME 134
gi 13124700  178 KKPLRTRIWDELVHYYHGFRLLFIDVA--ICSKLLWRVLNGKT----LTRRENKQLQRTTSDLFRLI-PFSVFIIVPFME 250
gi 81894519  117 KRSLRQKIVNELKYYYKGFSLLWIDTK--VAARIVWRLLHGNA----LTRRERRRLLRTCADVFRLV-PFMVFIIVPFME 189
gi 62510844  150 KKSLGQRVLDELKHYYHGFRLLWIDTK--IAARMLWRILNGHS----LTRRERRQFLRICADLFRLV-PFLVFVVVPFME 222
gi 75097031  127 LRHWKDEFKSTLQHYWLGTKLLWADVR--ISVRLLVKLANGKG----LSRRERQQLTRTTADIFRLV-PVAVFIIVPFME 199
gi 74766151   70 VSKLPYPAQKSFYAFSAGLRVQQKQFRywRSAQAKKKIDPHSY----ITYREEMAIYLLKKDFLKTAwIVPTFLFVPFGL 145
gi 74802814   93 IEKKFPSAVHVYRVFLVGVRDFFNDMK--KLVKITKIVYSHDNdlrcLTRKEIELYYQMPRDMRKVA-PVLLISALPFAN 169
gi 74765216  145 LEKNFPKAMQLYRVFFDGVKDFFGDMK--RFLKIARIANDSPQgiraLNGQELELYMQMPRDMMKVA-PALIGCSLPMVG 221
gi 74695806   78 KDPLWARVKHEVRHYVNGTKLLGYELK--ISFKLLVKFAKGYE----LSRRETNQLKRSMGDVFRLV-PFSAFLIIPFAE 150
gi 74695791   61 KPSLWSRVKHEAQHYWDGTKLLGLEVK--ISFKLVMKMSAGYE----LSRREMLQLKRTTTDVVRLV-PFSAFVIIPFAE 133
gi 74618774  146 KLTLKQKIKKEAQHYWDGTKLLAAEVR--ISSRLAIKMAAGYE----LTRRENRQLRRTVQDLGRLV-PFSMFVIVPFAE 218
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62510850  153 LFLPFALKLFP-NLLPSTYESGKDKQA----KRNKLIEIRKKTSEFLHETLEESNLITYNTIENAEKk--qKFLNFFRKL 225
gi 75028718  161 LALPIFIKLFP-GMLPSTFQESSKEEE----KWRKQVKLRVEMAKFLQDTIEEIGLERKTRNKESTRs--lEFALFIKKV 233
gi 74801714  135 LLLPLAIKLFP-GMLPSTFQTATERED----KIKQNLKVKIEMAKFLQKTLDDMAVQNKEHRSQAAK----DFSEFFTRI 205
gi 13124700  251 LLLPLFIKFFP-GMLPSTFQTSTDRQE----KLRQSLSVRLEVAKFLQQTLDQMPVQHKEHSSEEAK----QFEAFFTKI 321
gi 81894519  190 FLIPVFLKLFP-DMLPSTFESESKKEE----KQKKTMAAKLEIAKFLQETMTEMARRNRAKLGDASS----QLSSYVKQV 260
gi 62510844  223 FLLPVAVKLFP-NMLPSTFETQSLKEE----RLKKELRVKLELAKFLQDTIEEMALKNKAAKGSATK----DFSVFFQKI 293
gi 75097031  200 FLLPVFLKLFP-NMLPSTFQDKMKEEE----ALKRRLNARMEYAKFLQDTVKEMAKEVQTSRSGEIKktaeDLDGFMTKV 274
gi 74766151  146 FLIFIPVFLIPrYVLPDCYWTRDQRSK----YLTQLATSRTAEYGMI---LHHLSYHKDNLISQDRAk--qRLHALVQQV 216
gi 74802814  170 YVIFPLAYMYPrTLLTSHFWSAQQKLDfvqiDLRNRLLYNRRVFRCMQSKLDALKKTHDPA--YE------KFAYMLGLL 241
gi 74765216  222 YAFFPLVFYYPrSFLTAHFWTPQQRSEfqsyYMKRRLCNNKDVFRCLQAKLKATASHPKHS----------AFADILGQL 291
gi 74695806  151 LLLPFALKLFP-NMLPSTYVSGTERQQ----KRVKLEEVRRKTSNFLQETLEESSLINYNSVEGSEKr--kKFLSFFQKV 223
gi 74695791  134 LLLPIALKLFP-NMLSSTYESKTDKQK----KLENLRKTRAVMSEIIKEKKSHFKPSDITESQKM------IFNSFYKHV 202
gi 74618774  219 LLLPVALKLFP-NMLPSTYEEQKSKDK----KASTLRATRKEVSDFLRKTMKETGLPLTQVTAQKE-----EFSNFFRKV 288
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 62510850  226 YSAKEgKImtfqHDEISAIAQMFKNDS-VL--DNLSRPQLAAMSKFMSLRPFGNDNMLRYQIRSKLKDIMNDDKTIDYE- 301
gi 75028718  234 RNEGGyVS----NEELLKFSKLFEDEI-TL--DNLSMGQLRSLCRLMSINSLGSPEILRFQLNMKIRELKADDKQIAAEg 306
gi 74801714  206 RTTENft---isNEEILKFSKLFEDEI-TL--DSLNRQQLQALCRVLEVSPIGTSNLLRFQLRLKLRNLAADDRTIQKE- 278
gi 13124700  322 RNPTEpVS----NDEIIKFAKRFDDEI-TL--DSLSREQLAALCRVLELNTIGTTTLLRFQLRLKLRSLATDDRVIARE- 393
gi 81894519  261 QTGHK-PS----TKEIVRFSKLFKDQL-AL--EHLDRPQLVALCKLLELQTFGTNNLLRFQLLMTLKSIKADDEIIAKE- 331
gi 62510844  294 RETGErPS----NEEIMRFSKLFEDEL-TL--DNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRSIKADDKLIAEE- 365
gi 75097031  275 RRGVG-VS----NDEILGFAKLFNDEL-TL--DNINRSRLVNMCKYMGISPFGTDAYLRYMLRKRLQEIKKDDKLIKAE- 345
gi 74766151  217 SEGGV-PS----VDSILHLLPLFRDSSsLLriSDLPNPVLRSLCNTAFIVPFQTKSMAIRSLTRSMDFIFRLDRKLRDEd 291
gi 74802814  242 GSGLH-PT----SEEILDVKEVFQRPPfHL--NSLSSSHLKYLCR---LHDIHAGLLRRFRLSERAYVVHHMDMAIKREg 311
gi 74765216  292 GSGTH-PT----PEMLIDVKDIFAEGPySL--LGMSRKHVRNLVN---LHGLPSSIFKRHRLHEHAFLVHYMDQAITREg 361
gi 74695806  224 NSPKDgKTsvftHEEILSISKMFKNDT-VL--DNLSRPQLVAMAKYMSLRPFGTDNMLRYQIRYKLKSIMEDDKKIDYE- 299
gi 74695791  203 RETGEpES----REQLIQVARLFSDDT-VL--DNLTRPHLVAIAKYINLQPFGTDVMLRYRIRYKMLQLKKDDFALFYE- 274
gi 74618774  289 RSTGEkPT----AQDVIKVCKIFKDDL-TL--DNLSRPQLVSMCRYLNLNTFGTDMMLRYQLRHRMRQIKRDDRAISYE- 360
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|...
gi 62510850  302 GVESLSQEELYQACVSRGMKAYGVSKEDLVDNLKVWLELRLRQKIPSVLMVLS 354
gi 75028718  307 GVDALSSIDLQSACRARGMRAIGVSEERLKEQLVQWLELSLNDKVPPALLLLS 359
gi 74801714  279 GIASLNLSELQAACRARGMRAYGASEERLKSQLQEWINLSLNEKVPPSLLLLS 331
gi 13124700  394 GVDSLDLLELQQACKARGMRAYGLTEERLRFQLKEWIDLSLNEQVPPTLLLLS 446
gi 81894519  332 GVKALSVSELQSACRARGMRSLGLTEEQLCQQLTGWLDLHLKENVPPSLLLLS 384
gi 62510844  366 GVDSLNVKELQAACRARGMRALGVTEDRLRGQLKQWLDLHLHQEIPTSLLILS 418
gi 75097031  346 GVESLSEAELRQACRERGMLQLGSVEE-MREQLVDWLDLSLNHSVPSSLLILS 397
gi 74766151  292 LLHKLSPLHLEYATLMRGLDSLSLSPDANRYFLQHWLQVTRNCSADDTVFMLH 344
gi 74802814  312 GVHNMPIESLKHACYLRGLNANNLSAESMIEWLQEWVKVSLVVDEDCISMLLH 364
gi 74765216  362 GVHNLTPDALRYSCYLRGLNPDSLSSEAMIDWLRKWVKVSTSIQGEHITLFLH 414
gi 74695806  300 GVESLSTEELYSAAASRGIKAFGVSREDLVDKMNVWLELRLRQRIPSVLLILS 352
gi 74695791  275 GVDLLNSAELRTACASRGIRNLNVEDAVLRDNLNIWLNMRLKEKIPSTLLIMA 327
gi 74618774  361 GIETLSVAELQVACASRGIKSYGVSPARLREDLQTWLDLRLREGVPSTLLVLS 413
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap