Conserved Protein Domain Family
RGM_C

?
pfam06534: RGM_C (this model, PSSM-Id:219075 is obsolete and has been replaced by 428993)
Repulsive guidance molecule (RGM) C-terminus
This family consists of several mammalian and one bird sequence from Gallus gallus (Chicken). This family represents the C-terminal region of several sequences but in others it represents the full protein. All of the mammalian proteins are hypothetical and have no known function but RGMA from the chicken is annotated as being a repulsive guidance molecule (RGM). RGM is a GPI-linked axon guidance molecule of the retinotectal system. RGM is repulsive for a subset of axons, those from the temporal half of the retina. Temporal retinal axons invade the anterior optic tectum in a superficial layer, and encounter RGM expressed in a gradient with increasing concentration along the anterior-posterior axis. Temporal axons are able to receive posterior-dependent information by sensing gradients or concentrations of guidance cues. Thus, RGM is likely to provide positional information for temporal axons invading the optic tectum in the stratum opticum.
Statistics
?
PSSM-Id: 219075
Aligned: 10 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Dec-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9N0A6   232 QECVDQKVYQAEMDELPAAFVDGSKNGGDKHgANSLKITEKVSG---QHVEIRAKYIGTTIVVRQVGRYLTFAVRVPEEV 308 crab-eating macaque
Q6P8A4   219 QDCTDQKVYQAVTDDLPAAFVDGTTSGGDSD-SKSLRIIERVGG---KHVEMHARYIGTTVIVRQLGNYLTLAIRMPEEL 294 western clawed frog
Q6IYD1   219 QECTDQKVYQAVTDDLPAAFVDGTISGGDSE-TRSIWILEKSPG---RHVEIHAAYIGVTIIIRQQGRYLTLAVRMPEEL 294 zebrafish
Q8BSW1   172 HECTDQKVYQAVTDDLPAAFVDGTTSGGDCD-VKSLHIVEKESG---RYVEMHARYIGTTVFVRQLGRYLTLAIRMPEDL 247 house mouse
Q8N7M5   224 QECIDQKVYQAEVDNLPAAFEDGSVNGGDRPgGSSLSIQTANLG---SHVEIRAAYIGTTIIVRQTAGQLSFSIRVAEDV 300 Norway rat
Q6TDT6   214 RECAEQQVYQAKLGNVPPAFADGSVTGGDRRgHQSLRIHSHDPG---RHAEIWATHIGTMIIMRQVGQSLNLSVRSPRAI 290 zebrafish
Q6IYC9   209 QECVDQKTYRAETEDLPAAFIDGSKNGGEGHgANTLRVVEKVPG---QHVEIQARYIGTTIVVRKVGHYLTFAVRMPEEV 285 zebrafish
Q8JG54   205 QECVEQKVYQAEMDELPAAFADGSKNGGDKHgANSLKITEKVSG---QHIEIQAKYIGTTIVVRQVGRYLTFAVRMPEEV 281 chicken
ABS17664 208 QECVDQKVYQAEMDELPAAFVDGSKNGGDKSgANSLRIIEKVSG---QHIEIQAKYIGTTIVVRQVGRYLTFAVRMPEEV 284 Kenyan clawed frog
CAK04400 238 HDCTEQKVYQATTEDLPSAFQDGTRSGGK---GESLWIVEGSGGlgiRQVKIHARYLGTSIIVRQVGRYLTFAIRMPEDL 314 zebrafish
Q6P8A4   219 QDCTDQKVYQAVTDDLPAAFVDGTTSGGDSD-SKSLRIIERVGG---KHVEMHARYIGTTVIVRQLGNYLTLAIRMPEEL 294 western clawed frog
Q6IYD1   219 QECTDQKVYQAVTDDLPAAFVDGTISGGDSE-TRSIWILEKSPG---RHVEIHAAYIGVTIIIRQQGRYLTLAVRMPEEL 294 zebrafish
Q8BSW1   172 HECTDQKVYQAVTDDLPAAFVDGTTSGGDCD-VKSLHIVEKESG---RYVEMHARYIGTTVFVRQLGRYLTLAIRMPEDL 247 house mouse
Q8N7M5   224 QECIDQKVYQAEVDNLPAAFEDGSVNGGDRPgGSSLSIQTANLG---SHVEIRAAYIGTTIIVRQTAGQLSFSIRVAEDV 300 Norway rat
Q6TDT6   214 RECAEQQVYQAKLGNVPPAFADGSVTGGDRRgHQSLRIHSHDPG---RHAEIWATHIGTMIIMRQVGQSLNLSVRSPRAI 290 zebrafish
Q6IYC9   209 QECVDQKTYRAETEDLPAAFIDGSKNGGEGHgANTLRVVEKVPG---QHVEIQARYIGTTIVVRKVGHYLTFAVRMPEEV 285 zebrafish
Q8JG54   205 QECVEQKVYQAEMDELPAAFADGSKNGGDKHgANSLKITEKVSG---QHIEIQAKYIGTTIVVRQVGRYLTFAVRMPEEV 281 chicken
ABS17664 208 QECVDQKVYQAEMDELPAAFVDGSKNGGDKSgANSLRIIEKVSG---QHIEIQAKYIGTTIVVRQVGRYLTFAVRMPEEV 284 Kenyan clawed frog
CAK04400 238 HDCTEQKVYQATTEDLPSAFQDGTRSGGK---GESLWIVEGSGGlgiRQVKIHARYLGTSIIVRQVGRYLTFAIRMPEDL 314 zebrafish
Q9N0A6   309 VNAVEdwDSQGLYLCLRGCPLNQQIDFQaFHTNTEGt-----G---ARRLAAASPAPtaPETFPYETAVAKCKEKLPVED 380 crab-eating macaque
Q6P8A4   295 AMAYE--ESQDLQLCVNGCPTSERIDEG-GHLRLPV------Tv--SSTHDGSTVQT--ASLYTLESANEKCHEKIQVKH 361 western clawed frog
Q6IYD1   295 AMAFD--ETQDLQLCMNGCPTSERIDQE-GHLQLPVlglqqaGf--QQQQQPRVEAQ--RGVFTLESASRRCRDQLEVKD 367 zebrafish
Q8BSW1   248 AMSYE--ESQDLQLCVNGCPMSECIDDGqGQVSAIL------Gh--SLPHTTSVQAW--PG-YTLETASTQCHEKMPVKD 314 house mouse
Q8N7M5   301 ARAFS--AEQDLQLCVGGCPPSQRLSRSeRNRRGAI---------------------------AIDTARRLCKEGLPVED 351 Norway rat
Q6TDT6   291 VESYT--PEQDLQLCGWGCPISQRLEMLhAH--------------------------------PFDPAYTHCSSLFPGRD 336 zebrafish
Q6IYC9   286 VNSVEdqDNQDLYLCLHGCPANQRIDFRtFKARAAEs-----Hg--VGRGRPGNPSY----GFTYQSAMAKCKERLPVED 354 zebrafish
Q8JG54   282 VNAVEdrDSQGLYLCLRGCPLNQQIDFQtFRLAQAAe-----Gr--ARRKGPSLPAP--PEAFTYESATAKCREKLPVED 352 chicken
ABS17664 285 VNAVEdkDNQGLYLCLHGCPQNQQIDFRnFHFQAPEt-----G---LKRLTSASSAA--S--FTPQTAEAKCKEKLPVED 352 Kenyan clawed frog
CAK04400 315 A---E--ENGGLQLCLHGCPRSEVIKAHvLNRQQSLrpprlmGgwyGEDDGGEVKSGlsSHIDMLERATTKCREMLQVED 389 zebrafish
Q6P8A4   295 AMAYE--ESQDLQLCVNGCPTSERIDEG-GHLRLPV------Tv--SSTHDGSTVQT--ASLYTLESANEKCHEKIQVKH 361 western clawed frog
Q6IYD1   295 AMAFD--ETQDLQLCMNGCPTSERIDQE-GHLQLPVlglqqaGf--QQQQQPRVEAQ--RGVFTLESASRRCRDQLEVKD 367 zebrafish
Q8BSW1   248 AMSYE--ESQDLQLCVNGCPMSECIDDGqGQVSAIL------Gh--SLPHTTSVQAW--PG-YTLETASTQCHEKMPVKD 314 house mouse
Q8N7M5   301 ARAFS--AEQDLQLCVGGCPPSQRLSRSeRNRRGAI---------------------------AIDTARRLCKEGLPVED 351 Norway rat
Q6TDT6   291 VESYT--PEQDLQLCGWGCPISQRLEMLhAH--------------------------------PFDPAYTHCSSLFPGRD 336 zebrafish
Q6IYC9   286 VNSVEdqDNQDLYLCLHGCPANQRIDFRtFKARAAEs-----Hg--VGRGRPGNPSY----GFTYQSAMAKCKERLPVED 354 zebrafish
Q8JG54   282 VNAVEdrDSQGLYLCLRGCPLNQQIDFQtFRLAQAAe-----Gr--ARRKGPSLPAP--PEAFTYESATAKCREKLPVED 352 chicken
ABS17664 285 VNAVEdkDNQGLYLCLHGCPQNQQIDFRnFHFQAPEt-----G---LKRLTSASSAA--S--FTPQTAEAKCKEKLPVED 352 Kenyan clawed frog
CAK04400 315 A---E--ENGGLQLCLHGCPRSEVIKAHvLNRQQSLrpprlmGgwyGEDDGGEVKSGlsSHIDMLERATTKCREMLQVED 389 zebrafish
Q9N0A6   381 LYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYErtrdlpgrAAAGlplaPQPLLGALILLLALFP 455 crab-eating macaque
Q6P8A4   362 IYFHSCVFDLLTTGDANFTAAAFSAWEDVETLHPRKERWQIFP--------NKAGc--aNTHALPALVFGLAGLL 426 western clawed frog
Q6IYD1   368 IYFHSCVFDLLTTGDANFTTAAYNALKDMETLHPKKERWQIFP--------NSASr--lSPFSL-LLTALLSSFL 431 zebrafish
Q8BSW1   315 IYFQSCVFDLLTTGDANFTAAAHSALEDVEALHPRKERWHIFP--------SSCGgcrdLPVGLGLTCLILIMFL 381 house mouse
Q8N7M5   352 AYFQSCVFDVSVSGDPNFTVAAQSALDDARVFLTDLENLHLFPvdagpplsPATC----LVRLLSVLFVLWFCIQ 422 Norway rat
Q6TDT6   337 VYFQACLFDVQVTGDVNSSASAVAALEDARAMIFDPARVHLVTgg----tgNNSP---------SLLVVLGFSFL 398 zebrafish
Q6IYC9   355 LYFQSCVFDLLSSGDINFTLAAYYAFEDVKMLHSNKNKYHLFEkdt---ifNSAS------RKLAFSILIFISFV 420 zebrafish
Q8JG54   353 LYFQSCVFDLLTTGDVNFMLAAYYAFEDVKMLHSNKDKLHLYErtralapgNAAPs--eHPWALPALWVALLSLS 425 chicken
ABS17664 353 LYFQSCVFDLLTTGDVNFTLAAYYAFEDVKLLHSNKNKVHLFErttglgpsNTAPr---AGMDIPKLLVALACLI 424 Kenyan clawed frog
CAK04400 390 VYFQSCVFDLLTTGDPEFSMAAYGALEDLKALPPSTLK-QSSPrtppvsnrGTIV----TPSVFTAlvllllln- 458 zebrafish
Q6P8A4   362 IYFHSCVFDLLTTGDANFTAAAFSAWEDVETLHPRKERWQIFP--------NKAGc--aNTHALPALVFGLAGLL 426 western clawed frog
Q6IYD1   368 IYFHSCVFDLLTTGDANFTTAAYNALKDMETLHPKKERWQIFP--------NSASr--lSPFSL-LLTALLSSFL 431 zebrafish
Q8BSW1   315 IYFQSCVFDLLTTGDANFTAAAHSALEDVEALHPRKERWHIFP--------SSCGgcrdLPVGLGLTCLILIMFL 381 house mouse
Q8N7M5   352 AYFQSCVFDVSVSGDPNFTVAAQSALDDARVFLTDLENLHLFPvdagpplsPATC----LVRLLSVLFVLWFCIQ 422 Norway rat
Q6TDT6   337 VYFQACLFDVQVTGDVNSSASAVAALEDARAMIFDPARVHLVTgg----tgNNSP---------SLLVVLGFSFL 398 zebrafish
Q6IYC9   355 LYFQSCVFDLLSSGDINFTLAAYYAFEDVKMLHSNKNKYHLFEkdt---ifNSAS------RKLAFSILIFISFV 420 zebrafish
Q8JG54   353 LYFQSCVFDLLTTGDVNFMLAAYYAFEDVKMLHSNKDKLHLYErtralapgNAAPs--eHPWALPALWVALLSLS 425 chicken
ABS17664 353 LYFQSCVFDLLTTGDVNFTLAAYYAFEDVKLLHSNKNKVHLFErttglgpsNTAPr---AGMDIPKLLVALACLI 424 Kenyan clawed frog
CAK04400 390 VYFQSCVFDLLTTGDPEFSMAAYGALEDLKALPPSTLK-QSSPrtppvsnrGTIV----TPSVFTAlvllllln- 458 zebrafish
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap