Conserved Protein Domain Family
Tfb4

?
pfam03850: Tfb4 (this model, PSSM-Id:217761 is obsolete and has been replaced by 397778)
Transcription factor Tfb4
This family appears to be distantly related to the VWA domain.
Statistics
?
PSSM-Id: 217761
Aligned: 27 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 22-Dec-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q4WVC2        19 PSLLTIVLDTNPHAWALLEDS---L-------PLSTAIAN--------ILVFVNAHLACNYANEVAVVASHSQK-ATWLY 79  Aspergillus fum...
Q6Z2N2        11 VSLAVVVVDTNPLFWATAA-----L-------PFADFFAH--------LIHYVNSLLLLNHLNHVVVIAAGLSS-CTYIF 69  Oryza sativa Ja...
Q8LF41        13 VSLLVLLLDTNPLFWSTTS-----I-------TFSQFLSH--------VLAFLNAVLGLNQLNQVVVIATGYSS-CDYIY 71  thale cress
Q9LPQ2        13 VSLLVLLLDTNPLFWSTTS-----I-------TFSQFLSHvsvsnesiVLAFLNAVLGLNQLNQVVVIATGYSS-CDYIY 79  thale cress
Q09645        50 MSTLSVLIETSSCSWGMLASAhgdR-------TIGIILRA--------IVSFCNAHLGQSANNQLLVFAYGRNVdNKMIY 114 Caenorhabditis ...
Q16LU5         7 ASLLVIVMDTNPSQRIIRENP---H-------HLTQCLDS--------IVAFANAHLMQKAQNKLAVLACHHHA-TEFLY 67  yellow fever mo...
Q9VPX4        15 IDLLVIVLDTNPSQHFVRQNP---Q-------NLTQILEA--------VIAFGNAHLMQKAQNKLAVVSCSHHA-TNFLY 75  fruit fly
Q561R7         8 LNLLVIIVDTNPIWWGKQALKesqF-------TLSKCMDA--------VMVLANAHLFMNRSNQLAVIASHIQE-SRFLY 71  Norway rat
Q6DGV3         7 INILVIVLDVNPVWWGQQAQRepkF-------TLSACLDS--------LMVLANAHLVMSRTNKLAVITSLYHE-SHFLY 70  zebrafish
XP_001415467  12 kSLLVVLVETNPRYWAASEGK---GdgtaaanGLSSVLEA--------TTVFLNSFFALNQQNRAAVIAVHDDG-CHYLY 79  Ostreococcus lu...
Q6Z2N2        11 VSLAVVVVDTNPLFWATAA-----L-------PFADFFAH--------LIHYVNSLLLLNHLNHVVVIAAGLSS-CTYIF 69  Oryza sativa Ja...
Q8LF41        13 VSLLVLLLDTNPLFWSTTS-----I-------TFSQFLSH--------VLAFLNAVLGLNQLNQVVVIATGYSS-CDYIY 71  thale cress
Q9LPQ2        13 VSLLVLLLDTNPLFWSTTS-----I-------TFSQFLSHvsvsnesiVLAFLNAVLGLNQLNQVVVIATGYSS-CDYIY 79  thale cress
Q09645        50 MSTLSVLIETSSCSWGMLASAhgdR-------TIGIILRA--------IVSFCNAHLGQSANNQLLVFAYGRNVdNKMIY 114 Caenorhabditis ...
Q16LU5         7 ASLLVIVMDTNPSQRIIRENP---H-------HLTQCLDS--------IVAFANAHLMQKAQNKLAVLACHHHA-TEFLY 67  yellow fever mo...
Q9VPX4        15 IDLLVIVLDTNPSQHFVRQNP---Q-------NLTQILEA--------VIAFGNAHLMQKAQNKLAVVSCSHHA-TNFLY 75  fruit fly
Q561R7         8 LNLLVIIVDTNPIWWGKQALKesqF-------TLSKCMDA--------VMVLANAHLFMNRSNQLAVIASHIQE-SRFLY 71  Norway rat
Q6DGV3         7 INILVIVLDVNPVWWGQQAQRepkF-------TLSACLDS--------LMVLANAHLVMSRTNKLAVITSLYHE-SHFLY 70  zebrafish
XP_001415467  12 kSLLVVLVETNPRYWAASEGK---GdgtaaanGLSSVLEA--------TTVFLNSFFALNQQNRAAVIAVHDDG-CHYLY 79  Ostreococcus lu...
Q4WVC2        80 PCETkedngkstsktGRDEDGDVAMNGSGAgagagfaaaqvNKYRPFRIVEEQVTRNLRELMDSTSGADVAATTsTMM-A 158 Aspergillus fum...
Q6Z2N2        70 DSSD------------ASASGAADVAA--------------TFAKASRKMDEFIAEDARATSSNGSVADGNA---ASLlS 120 Oryza sativa Ja...
Q8LF41        72 DSSL------------TSNHGNFESNGTGMp---------aIFGSLLKKLEEFVTKDEELSKEEVSEDRIPS---CLL-S 126 thale cress
Q9LPQ2        80 DSSL------------TSNHGNFESNGTGMp---------aIFGSLLKKLEEFVTKDEELSKEEVSEDRIPS---CLLwP 135 thale cress
Q09645       115 SSTR----------------------------------------CEDRNASFLVVKRLRELLSSDALTNDATIG-APL-G 152 Caenorhabditis ...
Q16LU5        68 PTPG----------------KPLDIRQVD------------GQYEAFTLVEKTIKQKLAKVISEAPRLTVPTE--SLL-A 116 yellow fever mo...
Q9VPX4        76 PLPR----------------RQVELRQVD------------GQYEAFNLVEKTVKQQLGSILMNAPRLSAPCE--SLL-A 124 fruit fly
Q561R7        72 PGKNgrlgd--ffgdPGNALPDCNPSGSKD-----------GKYELLTAANEVIAEEIKDLMTKSDIKGQHTE--TLL-A 135 Norway rat
Q6DGV3        71 PSKQ--------------WRSGEEISANPD-----------GKYELLSVTNDLFAEEIRNLMERAEVSGSQTE--TLL-A 122 zebrafish
XP_001415467  80 TSPL-----------------------------------------ELNAGDASASATGKKRTKTATPSSRAAMS-SPF-A 116 Ostreococcus lu...
Q6Z2N2        70 DSSD------------ASASGAADVAA--------------TFAKASRKMDEFIAEDARATSSNGSVADGNA---ASLlS 120 Oryza sativa Ja...
Q8LF41        72 DSSL------------TSNHGNFESNGTGMp---------aIFGSLLKKLEEFVTKDEELSKEEVSEDRIPS---CLL-S 126 thale cress
Q9LPQ2        80 DSSL------------TSNHGNFESNGTGMp---------aIFGSLLKKLEEFVTKDEELSKEEVSEDRIPS---CLLwP 135 thale cress
Q09645       115 SSTR----------------------------------------CEDRNASFLVVKRLRELLSSDALTNDATIG-APL-G 152 Caenorhabditis ...
Q16LU5        68 PTPG----------------KPLDIRQVD------------GQYEAFTLVEKTIKQKLAKVISEAPRLTVPTE--SLL-A 116 yellow fever mo...
Q9VPX4        76 PLPR----------------RQVELRQVD------------GQYEAFNLVEKTVKQQLGSILMNAPRLSAPCE--SLL-A 124 fruit fly
Q561R7        72 PGKNgrlgd--ffgdPGNALPDCNPSGSKD-----------GKYELLTAANEVIAEEIKDLMTKSDIKGQHTE--TLL-A 135 Norway rat
Q6DGV3        71 PSKQ--------------WRSGEEISANPD-----------GKYELLSVTNDLFAEEIRNLMERAEVSGSQTE--TLL-A 122 zebrafish
XP_001415467  80 TSPL-----------------------------------------ELNAGDASASATGKKRTKTATPSSRAAMS-SPF-A 116 Ostreococcus lu...
Q4WVC2       159 GALTLALSHINRR-SIAWA-DahggtaagppgaveagssgagragadtgaEGLQSRILIi--sVSGSTDSAHQYIPIMNC 234 Aspergillus fum...
Q6Z2N2       121 GALSLALCYIQRVfRSGT--------------------------------RHPQPRILC----LQGSPDGPEQYVAVMNS 164 Oryza sativa Ja...
Q8LF41       127 GSLSMALCYIQRVfRSGH--------------------------------LHPQPRILC----LQGSPDGPEQYVAVMNS 170 thale cress
Q9LPQ2       136 GTVCFFLHFFSTC------------------------------------------KILSclsgLIKRFCHSFRYVAVMNS 173 thale cress
Q09645       153 PALAHAFCHMKKDsRVVTA-Dpcddslgpqt----------tseqsetasEKATNRAVV----ISITPIMGSEHGSLMNL 217 Caenorhabditis ...
Q16LU5       117 GSMAMALCYIARVhRNKPA-G-----------------------------VKINSRILV----VTGSNECASQYMTYMNV 162 yellow fever mo...
Q9VPX4       125 GSMSMALCYISRLqRNLAP-G-----------------------------VKMHSRILV----VTGSNECASQYMTFMNV 170 fruit fly
Q561R7       136 GSLAKALCYIHRAsKAVKD-N-----------------------------QEMKSRILV----IKAAEDSALQYMNFMNV 181 Norway rat
Q6DGV3       123 VSLARALCYINRIsKDVQA-G-----------------------------QEVKSRILV----IKAAEDSTSQYMNFMNV 168 zebrafish
XP_001415467 117 GALSLALCYCNRAqTLETAaG-----------------------------LRVRPRILC----LQASQDNPTDYISMMNA 163 Ostreococcus lu...
Q6Z2N2       121 GALSLALCYIQRVfRSGT--------------------------------RHPQPRILC----LQGSPDGPEQYVAVMNS 164 Oryza sativa Ja...
Q8LF41       127 GSLSMALCYIQRVfRSGH--------------------------------LHPQPRILC----LQGSPDGPEQYVAVMNS 170 thale cress
Q9LPQ2       136 GTVCFFLHFFSTC------------------------------------------KILSclsgLIKRFCHSFRYVAVMNS 173 thale cress
Q09645       153 PALAHAFCHMKKDsRVVTA-Dpcddslgpqt----------tseqsetasEKATNRAVV----ISITPIMGSEHGSLMNL 217 Caenorhabditis ...
Q16LU5       117 GSMAMALCYIARVhRNKPA-G-----------------------------VKINSRILV----VTGSNECASQYMTYMNV 162 yellow fever mo...
Q9VPX4       125 GSMSMALCYISRLqRNLAP-G-----------------------------VKMHSRILV----VTGSNECASQYMTFMNV 170 fruit fly
Q561R7       136 GSLAKALCYIHRAsKAVKD-N-----------------------------QEMKSRILV----IKAAEDSALQYMNFMNV 181 Norway rat
Q6DGV3       123 VSLARALCYINRIsKDVQA-G-----------------------------QEVKSRILV----IKAAEDSTSQYMNFMNV 168 zebrafish
XP_001415467 117 GALSLALCYCNRAqTLETAaG-----------------------------LRVRPRILC----LQASQDNPTDYISMMNA 163 Ostreococcus lu...
Q4WVC2       235 IFACQRLHIPIDVCKLSG--DAVFLQQASDATKGVYMSLSEPRGLLQYLMMAFLPDQRSRRHLVIPTRVDVDFRAACFCH 312 Aspergillus fum...
Q6Z2N2       165 IFSAQRSMVPIDSCIV-GtqDSAFLQQASYITGGVYLKPQELNGLFQYLAAVFATDLHSRTFLRLPKTLGVDFRASCFCH 243 Oryza sativa Ja...
Q8LF41       171 IFSAQRLMVPIDSCYI-GvqNSAFLQQASYITGGVHHTPKQLDGLFQYLTTIFATDLHSRGFVQLPKPIGVDFRASCFCH 249 thale cress
Q9LPQ2       174 IFSAQRLMRT---------------QYSMAANSGLFCFAQK---------TIFATDLHSRGFVQLPKPIGVDFRASCFCH 229 thale cress
Q09645       218 FFSAAKQSICVDVVSMGDdfTGGILQQAADITGGSFLHAKKPQTLLKILMTNMLTDPTHRAVFSKLSHNSVDYRASCACH 297 Caenorhabditis ...
Q16LU5       163 FFTAQKQNVSLDVCALDK--PLSLLQQGCDITGGQYLKLPQLDGFLQYLLWVFLPEPLTRCKLVLPPPVKVDYRAACFCH 240 yellow fever mo...
Q9VPX4       171 FFTAQKLGITIDTCALDK--TLSLLQQGCDITSGQFLKVTQLDGLLQYLLWVFLPAPQIRHKLVLPPPPKVDYRASCFCH 248 fruit fly
Q561R7       182 IFAAQKQNILIDACVLDS--DSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPIHVDYRAACFCH 259 Norway rat
Q6DGV3       169 IFAAQKKNILIDACVLDS--DSGLLQQACDITGGLYLRVPQKVALTQYLLWAFLPDAEQRSQLLLPPPVHVDYRAACFCH 246 zebrafish
XP_001415467 164 IFSAQRQSIPIDAFALGEh-DLPFLQQAAHITRGAYVKPTHGAGLLQYLLSTAALDMRSRSHLKLPAARGVDFRASCFCH 242 Ostreococcus lu...
Q6Z2N2       165 IFSAQRSMVPIDSCIV-GtqDSAFLQQASYITGGVYLKPQELNGLFQYLAAVFATDLHSRTFLRLPKTLGVDFRASCFCH 243 Oryza sativa Ja...
Q8LF41       171 IFSAQRLMVPIDSCYI-GvqNSAFLQQASYITGGVHHTPKQLDGLFQYLTTIFATDLHSRGFVQLPKPIGVDFRASCFCH 249 thale cress
Q9LPQ2       174 IFSAQRLMRT---------------QYSMAANSGLFCFAQK---------TIFATDLHSRGFVQLPKPIGVDFRASCFCH 229 thale cress
Q09645       218 FFSAAKQSICVDVVSMGDdfTGGILQQAADITGGSFLHAKKPQTLLKILMTNMLTDPTHRAVFSKLSHNSVDYRASCACH 297 Caenorhabditis ...
Q16LU5       163 FFTAQKQNVSLDVCALDK--PLSLLQQGCDITGGQYLKLPQLDGFLQYLLWVFLPEPLTRCKLVLPPPVKVDYRAACFCH 240 yellow fever mo...
Q9VPX4       171 FFTAQKLGITIDTCALDK--TLSLLQQGCDITSGQFLKVTQLDGLLQYLLWVFLPAPQIRHKLVLPPPPKVDYRASCFCH 248 fruit fly
Q561R7       182 IFAAQKQNILIDACVLDS--DSGLLQQACDITGGLYLKVPQMPSLLQYLLWVFLPDQDQRSQLILPPPIHVDYRAACFCH 259 Norway rat
Q6DGV3       169 IFAAQKKNILIDACVLDS--DSGLLQQACDITGGLYLRVPQKVALTQYLLWAFLPDAEQRSQLLLPPPVHVDYRAACFCH 246 zebrafish
XP_001415467 164 IFSAQRQSIPIDAFALGEh-DLPFLQQAAHITRGAYVKPTHGAGLLQYLLSTAALDMRSRSHLKLPAARGVDFRASCFCH 242 Ostreococcus lu...
Q4WVC2       313 RRVVDIGFVCSICLSIFCEP--PEngdCLTCG 342 Aspergillus fumigatus
Q6Z2N2       244 KKTIDMGYVCSVCLSIFCKYhkK----CSTCG 271 Oryza sativa Japonica Group
Q8LF41       250 KKTIDMGYICSVCLSIFCEHhkK----CSTCG 277 thale cress
Q9LPQ2       230 KKTIDMGYICSVCLSIFCEHhkK----CSTCG 257 thale cress
Q09645       298 HQLVSSGWVCSICLSVLCQYt-PI---CKVCK 325 Caenorhabditis elegans
Q16LU5       241 RELIDIGYVCSVCLSIFCKFs-PI---CTTCH 268 yellow fever mosquito
Q9VPX4       249 RELIDIGYVCSVCLSVFCKYs-PI---CTTCH 276 fruit fly
Q561R7       260 RSLIEIGYVCSVCLSIFCNFs-PI---CTTCE 287 Norway rat
Q6DGV3       247 RNLIEIGYVCSVCLSIFCNFs-PI---CTTCE 274 zebrafish
XP_001415467 243 KRPVSVGFVCSVCLSIFCERr-SS---CDTCG 270 Ostreococcus lucimarinus CCE9901
Q6Z2N2       244 KKTIDMGYVCSVCLSIFCKYhkK----CSTCG 271 Oryza sativa Japonica Group
Q8LF41       250 KKTIDMGYICSVCLSIFCEHhkK----CSTCG 277 thale cress
Q9LPQ2       230 KKTIDMGYICSVCLSIFCEHhkK----CSTCG 257 thale cress
Q09645       298 HQLVSSGWVCSICLSVLCQYt-PI---CKVCK 325 Caenorhabditis elegans
Q16LU5       241 RELIDIGYVCSVCLSIFCKFs-PI---CTTCH 268 yellow fever mosquito
Q9VPX4       249 RELIDIGYVCSVCLSVFCKYs-PI---CTTCH 276 fruit fly
Q561R7       260 RSLIEIGYVCSVCLSIFCNFs-PI---CTTCE 287 Norway rat
Q6DGV3       247 RNLIEIGYVCSVCLSIFCNFs-PI---CTTCE 274 zebrafish
XP_001415467 243 KRPVSVGFVCSVCLSIFCERr-SS---CDTCG 270 Ostreococcus lucimarinus CCE9901
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap