1VLB,2W55,1V97,1T3Q,1N60,1SB3


Conserved Protein Domain Family
Ald_Xan_dh_C

?
pfam01315: Ald_Xan_dh_C (this model, PSSM-Id:216430 is obsolete and has been replaced by 334486)
Click on image for an interactive view with Cn3D
Aldehyde oxidase and xanthine dehydrogenase, a/b hammerhead domain
Statistics
?
PSSM-Id: 216430
View PSSM: pfam01315
Aligned: 30 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Dec-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1VLB_A      192 TLDYGADLGLKMPAGTlHLAMVQAKVSHANIKGIDTSEALTMPGVHSVITHKDVKGKNRITGli-tFPTNkgdgwdrpIL 270
gi 2495497   34 TARYAYEWHEEAPNAA-YGYIVGSAIAKGRLTALDTDAAQKAPGVLAVITASNAGALGKGDK----NTAR--------LL 100
gi 81554669  34 TGEFAYASDMWHEDML-WGQILRSTVAHAEIVSVDTGEALATPGVYAVMTYDDLPTDVRHYGl---EIRDt------pVL 103
gi 23396898  18 TGELKYMTDLSFPGML-YGKVLRSAYPHAEIVSVCTIKAEKMEGVQAVVTHKDVPGLNRFGi----VIPDq------pVL 86
1N60_E       35 QGKGNYVDDVKLPGML-FGDFVRSSHAHARIKSIDTSKAKALPGVFAVLTAADLKPLNLHYMptlaGDvq-------aVL 106
gi 75348883  29 QGKGNYVDDIKLPGMV-HMDIVRSPLAHARIKRINKEAALQVPGVLAVLTAEDLKPLKLHWMptlaGDva-------aVL 100
gi 74567021  11 IGKGNYVDDISYKGKY--AVFIRSPYAHARIVNINKEDAERRG--ALVLTGKDLVSRNVESGeregASLTt------pLM 80
gi 74567125  17 TGSGRYIDDIEYPGTL-YLYIVRSNVAHAKIKYIDVRDALKVNGVVGVITGLTIPFENRP------NNWP---------M 80
gi 75345579  25 TGRARYTADLDHTGAL-VARILRSPISHGDIVRLDVSKALALDGVAAIVTGEDCAIT-YGVLpiamNEy---------PM 93
1SB3_D       25 TGKAKYTADIAAPDAL-VGRILRSPHAHARILAIDTSAAEALEGVIAVCTGAETPVP-FGVLpiaeNEy---------PL 93
                        90       100       110
                ....*....|....*....|....*....|....*...
1VLB_A      271 CDEKVFQYGDCIALVCADSEANARAAAEKVKVDLEELP 308
gi 2495497  101 GGPTIEHYHQAIALVVAETFEQARAAASLVQAHYRRNK 138
gi 81554669 104 AHGKVRHHGEPVAIVAADHPETARRAAAKVKVEYRELP 141
gi 23396898  87 CEDRVRYVGDAIAAVAAETEEIAEAALELIQVEYKELE 124
1N60_E      107 ADEKVLFQNQEVAFVVAKDRYVAADAIELVEVDYEPLP 144
gi 75348883 101 ADGKVHFQMQEVAVVIAEDPYAAADGVEAVEVEYEELP 138
gi 74567021  81 AINKALYVGQPVALVIANDPYEATDLAELVQIDYEPLE 118
gi 74567125  81 AKDEILYVGHPIAAILATDKYVAADAADLIQVDYEELP 118
gi 75345579  94 ARDRVRYRGEPVAAVAAVDAETARQALDLIELELRELP 131
1SB3_D       94 ARDKVRYRGDPVAAVAAIDEVTAEKALALIKVDYEVLP 131
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap