1XBR,1H6F


Conserved Protein Domain Family
T-box

?
pfam00907: T-box (this model, PSSM-Id:216184 is obsolete and has been replaced by 307177)
Click on image for an interactive view with Cn3D
T-box
The T-box encodes a 180 amino acid domain that binds to DNA. Genes encoding T-box proteins are found in a wide range of animals, but not in other kingdoms such as plants. Family members are all thought to bind to the DNA consensus sequence TCACACCT. they are found exclusively in the nucleus, and perform DNA-binding and transcriptional activation/repression roles. They are generally required for development of the specific tissues they are expressed in, and mutations in T-box genes are implicated in human conditions such as DiGeorge syndrome and X-linked cleft palate, which feature malformations.
Statistics
?
PSSM-Id: 216184
View PSSM: pfam00907
Aligned: 24 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Dec-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1XBR_A        3 KVSLEERDLWTRFKELTNEMIVTKNGRRMFPVLKVSMSGLDPNAMYTVLLDFVAADNHRWK--YVNGEWVPGGKPEPQAP 80
gi 74957411  32 RVFLQSSNLWRRFHNLGTEMIVTKSGRRMFPTLSVIIAGLDPVKSYVVMVDLECIEMKRFRysFHQSKWISTGPGESELP 111
gi 2501134    8 TLSSTTDPLWRSCHEYDNEMVITVNGRRIFPTLEYTVTGLDTFKLYSMCMHLDLVDDKKLR--FTGGQWAESVSTEKKDP 85
gi 51704314   8 TLREDQDKLWNLFHYHKNEMIVTKSGRKMFPKLEYVVRGLTPNKLYAMMLHIEPSDDHRYK--FSSGEWVKSGKAEKHRE 85
gi 2501122  205 QVYLCNRPLWLKFHRHQTEMIITKQGRRMFPFLSFNISGLDPTAHYNIFVDVILADPNHWR--FQGGKWVPCGKADTNVQ 282
gi 17372819  88 RISLDDRELWLRFQNLTNEMIVTKNGRRMFPVVKISASGLDPAAMYTVLLEFVQIDSHRWK--YVNGEWVPGGKAEVPPS 165
gi 2501112   16 RLTLNDRALWTKFCSLTNEMIVTKSGRRMFPVLKLTASGLEPNSMYSFLLDFAPADSNRWK--YVNGEWVPGGKPEPHAA 93
gi 2501126   40 QVVLEDAPLWQRFREVTNEMIVTKNGRRMFPVLKISVSGLDPNAMYSFLLDFAPTDGHRWK--YVNGEWVPAGKPEPPNH 117
gi 2501110   36 KLSLEDAELWTKFKELTNEMIVTKTGRRMFPVLRASVTGLDPNAMYSVLLDFVAADNNRWK--YVNGEWVPGGKPEPQSP 113
gi 2501113   42 KVRLDDVELWKKFHKLTNEMIVTKSGRRMFPVLSASIAGLDPNSMYSVLLDFSAADDHRWK--YVNGEWIPGGKPDGSPP 119
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1XBR_A       81 -SCVYIHPDSPNFGAHWMKDPVSFSKVKLTNK--M-NGGGQ-IMLNSLHKYEPRIHIVRVGG---------TQRMITSHS 146
gi 74957411 112 -SRMFVHTDSPARGAHWMRAPVSFDKMKLTNNq-L-DNNGH-IIVNSMHKYRPRVHIIEQDDs---------QKRH-TFS 177
gi 2501134   86 -PRKVWHHNGSQTGKDWMLRNVSFDQIRITNRksKeDGNASyVHLLTQHRYIPVLTIYEGDQl------------VHTAR 152
gi 51704314  86 -PKKLWHADGVRSGKEWMTNPVCFDRVKITNCa--eSTNASmIFLHSMHKYTPVMSIYESPSespfsvpqpSTRLVTSVR 162
gi 2501122  283 gNRVYMHPDSPNTGAHWMRQEISFGKLKLTNNkgAsNNNGQmVVLQSLHKYQPRLHVVEVNEdgte-dtsqP-GRVQTFT 360
gi 17372819 166 -NPIYVHPESPNFGAHWMKEPISFAKVKLTNKt---NGNGQ-IMLNSLHKYEPRVHLVRVGSe---------QRHVVTYP 231
gi 2501112   94 -SCVYVHPDSPNFGSHWMKQPVSFNKVKLTNKg---NGGGQqIMLNSLHKYEPRIHVVKVGGea------aSERTIATFS 163
gi 2501126  118 -SCVYIHPDSPNFGAHWMKAAISFSKVKLTNKl---NGSGQ-IMLNSLHKYEPQVHIVRVGGp---------hRMVMNCS 183
gi 2501110  114 -SCVYIHPDSPNFGAHWMKAPVSFSKVKLSNKl---NGGGQ-IMLNSLHKYEPRIHIVKVGGi---------QKMISSQS 179
gi 2501113  120 -TTAYIHPDSPNFGAHWMKQAVNFSKVKLSNKl---NGSGQ-VMLNSLHKYEPRIHIIRVGGre-------kqRLVGSYS 187
                       170       180       190
                ....*....|....*....|....*....|....
1XBR_A      147 FPETQFIAVTAYQNEEITALKIKHNPFAKAFLDA 180
gi 74957411 178 FEETEFIAVTAYQNHRITSLKIESNPFAKGFREC 211
gi 2501134  153 IPHSQFISVTAYHKGELNTLKTNNNPYSTGSRKD 186
gi 51704314 163 LTYTEFIAVTAYQNDAVIKLKIKFNPFAKGFREG 196
gi 2501122  361 FPETQFIAVTAYQNTDITQLKIDHNPFAKGFRDN 394
gi 17372819 232 FPETQFIAVTAYQNEEVTSLKIKYNPFAKAFLDA 265
gi 2501112  164 FPESQFIAVTAYQNEEVTSLKIKHNPFAKAFLDA 197
gi 2501126  184 FPETQFIAVTAYQNEEITALKIKYNPFAKAFLDA 217
gi 2501110  180 FPETQFIAVTAYQNEEITALKIKHNPFAKAFLDA 213
gi 2501113  188 FTETRFIAVTAYQNEDITQLKIKYNPFAKAFLDI 221
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap