3EQA,2F6D,1LF6


Conserved Protein Domain Family
Glyco_hydro_15

?
pfam00723: Glyco_hydro_15 (this model, PSSM-Id:216082 is obsolete and has been replaced by 395586)
Click on image for an interactive view with Cn3D
Glycosyl hydrolases family 15
In higher organisms this family is represented by phosphorylase kinase subunits.
Statistics
?
PSSM-Id: 216082
Aligned: 29 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Dec-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3EQA_A   13 VARTAILNNIGADGAWVSGADSGIVVASPSTDNPdyf---------ytWTRDSGLVLKTLV---------------DLFR 68   Aspergillus niger
Q9W391    9 VRLDYYQRIVHRLILAHQEPVTGLFPASNVNSHA--------------WIRDNVYCILAVWglsmaykkiadqdedRAKC 74   fruit fly
Q8YW30    9 ARLEYYYQQIKTVIMIRQNPITGLLPASTAITAHgdy--------tdaWVRDNVYSILAVWglalay---rkvdedQGRT 77   Nostoc sp. PCC 7120
Q9VLS1   49 KQLDIYYGIVKRQLLRYQSPITGLFPVMSTdqv-------------vgSVRDSVYCASAVWslyqay---rridddRGKS 112  fruit fly
Q9EWZ6  236 RHAYAVLHGLTSV--------SGGMVAAATTSLPeransgrnydyryaWLRDQCYAALAVAahgph------plvdDAVR 301  Streptomyces coelic...
Q97V93  208 SFNDLYKASIYTMLGSIYAP-SGGVIAAPTTSLPeveggkrnwdyrfaWVRDSSIIAEALLeags-------iveaRRII 279  Sulfolobus solfatar...
Q9RJ38  217 PHRDAVVRSLITLKALTYQP-TGGIVAAPTTSLPeepggvrnwdyrfcWLRDSTLTLGALLsagy-------leeaEAWR 288  Streptomyces coelic...
Q9S223  232 PYREAVVRSLITLKALTYAP-TGGIVAAPTTSLPediggvrnwdyrytWLRDAAITLSSLLrtgy-------reeaRAWR 303  Streptomyces coelic...
Q9KYJ7  223 PYREAVVRSSIALKAMTYGP-SGGIVAAPTTSLPeeiggqrnwdyrysWLRDASTTLAALLgtgy-------lqeaQAWR 294  Streptomyces coelic...
Q10211  256 RYREFVQRNALTLKLLIYEP-TGAVIASPTFSLPedlggvrnwdyrftWIRDSAFTIYALAqlgf-------raeaVEYM 327  Schizosaccharomyces...
Q9W391    9 VRLDYYQRIVHRLILAHQEPVTGLFPASNVNSHA--------------WIRDNVYCILAVWglsmaykkiadqdedRAKC 74   fruit fly
Q8YW30    9 ARLEYYYQQIKTVIMIRQNPITGLLPASTAITAHgdy--------tdaWVRDNVYSILAVWglalay---rkvdedQGRT 77   Nostoc sp. PCC 7120
Q9VLS1   49 KQLDIYYGIVKRQLLRYQSPITGLFPVMSTdqv-------------vgSVRDSVYCASAVWslyqay---rridddRGKS 112  fruit fly
Q9EWZ6  236 RHAYAVLHGLTSV--------SGGMVAAATTSLPeransgrnydyryaWLRDQCYAALAVAahgph------plvdDAVR 301  Streptomyces coelic...
Q97V93  208 SFNDLYKASIYTMLGSIYAP-SGGVIAAPTTSLPeveggkrnwdyrfaWVRDSSIIAEALLeags-------iveaRRII 279  Sulfolobus solfatar...
Q9RJ38  217 PHRDAVVRSLITLKALTYQP-TGGIVAAPTTSLPeepggvrnwdyrfcWLRDSTLTLGALLsagy-------leeaEAWR 288  Streptomyces coelic...
Q9S223  232 PYREAVVRSLITLKALTYAP-TGGIVAAPTTSLPediggvrnwdyrytWLRDAAITLSSLLrtgy-------reeaRAWR 303  Streptomyces coelic...
Q9KYJ7  223 PYREAVVRSSIALKAMTYGP-SGGIVAAPTTSLPeeiggqrnwdyrysWLRDASTTLAALLgtgy-------lqeaQAWR 294  Streptomyces coelic...
Q10211  256 RYREFVQRNALTLKLLIYEP-TGAVIASPTFSLPedlggvrnwdyrftWIRDSAFTIYALAqlgf-------raeaVEYM 327  Schizosaccharomyces...
3EQA_A   69 NG-DTSLLSTIEN-YISAQAIVQGISNPSGDLSSGa-GLGEPKFNVDETAYTGS--WGRPQRDGPALRATAMIGFgqwlL 143  Aspergillus niger
Q9W391   75 YElEQSCVKLMRG-LLMAMMNQKDKVEKFKMTQSPydSLHAKYSSKNGLPVVDDneWGHLQIDAVSLYLLILAQM----T 149  fruit fly
Q8YW30   78 YElEHSVIKLMRG-LLFAMMRQAHKVEQFKQTQSPldGLHAKYNTATGDIVVGDdeWGHLQLDATSIFLLMLAQM----T 152  Nostoc sp. PCC 7120
Q9VLS1  113 YElGQSTVKCMRG-ILECWVKQASRVELFKQRQSNqhALHSKFQLHTGEKIYPDefYNHLQIDCVSLYLLFLVQM----I 187  fruit fly
Q9EWZ6  302 FVaERILADGDR---VRPAYTVDG--RPVGKERSL----RLPGYPGGNDH-VGNdaGAQFQLDTFGEALQLFAAA----- 366  Streptomyces coelic...
Q97V93  280 NFlLSLINFSSKP-FYYPLYTIEGT-IPPPERELR----WLSGYKNSKPVRIGNgaSSQIQLDIEGFFISALYKYv--kM 351  Sulfolobus solfatar...
Q9RJ38  289 DWlLRAVAGNPAD--LQIMYGVAGE-RRLPEYELP----WLSGFAGSAPVRIGNdaVNQLQLDVYGEVMDSLSLA----R 357  Streptomyces coelic...
Q9S223  304 EWlLRAVAGDPEN--LQIMYGIAGE-RELGEAELD----WLPGYEGSGPVRVGNgaAHQLQLDVYGEVTEALHLG----H 372  Streptomyces coelic...
Q9KYJ7  295 RWlLRAVAGDPEN--LQIMYGITGD-RDLRERELP----WLPGYEGSSPVRVGNgaADQLQLDVYGEVIDTLYLA----Y 363  Streptomyces coelic...
Q10211  328 SFiYHVLKKKNKDgGINIVYSIHGDSQNLEEVELT----HLRGYYNSHPVRIGNaaVHHLQLDIYGELMDSIYIY----D 399  Schizosaccharomyces...
Q9W391   75 YElEQSCVKLMRG-LLMAMMNQKDKVEKFKMTQSPydSLHAKYSSKNGLPVVDDneWGHLQIDAVSLYLLILAQM----T 149  fruit fly
Q8YW30   78 YElEHSVIKLMRG-LLFAMMRQAHKVEQFKQTQSPldGLHAKYNTATGDIVVGDdeWGHLQLDATSIFLLMLAQM----T 152  Nostoc sp. PCC 7120
Q9VLS1  113 YElGQSTVKCMRG-ILECWVKQASRVELFKQRQSNqhALHSKFQLHTGEKIYPDefYNHLQIDCVSLYLLFLVQM----I 187  fruit fly
Q9EWZ6  302 FVaERILADGDR---VRPAYTVDG--RPVGKERSL----RLPGYPGGNDH-VGNdaGAQFQLDTFGEALQLFAAA----- 366  Streptomyces coelic...
Q97V93  280 NFlLSLINFSSKP-FYYPLYTIEGT-IPPPERELR----WLSGYKNSKPVRIGNgaSSQIQLDIEGFFISALYKYv--kM 351  Sulfolobus solfatar...
Q9RJ38  289 DWlLRAVAGNPAD--LQIMYGVAGE-RRLPEYELP----WLSGFAGSAPVRIGNdaVNQLQLDVYGEVMDSLSLA----R 357  Streptomyces coelic...
Q9S223  304 EWlLRAVAGDPEN--LQIMYGIAGE-RELGEAELD----WLPGYEGSGPVRVGNgaAHQLQLDVYGEVTEALHLG----H 372  Streptomyces coelic...
Q9KYJ7  295 RWlLRAVAGDPEN--LQIMYGITGD-RDLRERELP----WLPGYEGSSPVRVGNgaADQLQLDVYGEVIDTLYLA----Y 363  Streptomyces coelic...
Q10211  328 SFiYHVLKKKNKDgGINIVYSIHGDSQNLEEVELT----HLRGYYNSHPVRIGNaaVHHLQLDIYGELMDSIYIY----D 399  Schizosaccharomyces...
3EQA_A  144 DNGytSTATDIVWPL---VRNDLSYVAQYWNQTGYDLWE----EVNGSSFF--TIAVQHRALVEGSAFATAVG--S---- 208  Aspergillus niger
Q9W391  150 ASG--LQIVFSLDEVs-fIQNLVFYIESAYSIPDYGIWErgdkTNHGEPELnaSSIGMAKAALEAMNELDLFGarGgpas 226  fruit fly
Q8YW30  153 ASG--LQIIYTIDEVn-fVQNLVYYIGRAYRTPDYGIWErgnkINHGNAELnaSSVGMAKAALEAMNELDLFGvrGsqas 229  Nostoc sp. PCC 7120
Q9VLS1  188 TSG--LQIIYTHDEVa-fVQNLVYYVERAYRTPDFGMWErgskYNNGTPEIhaSSIGMAKSALEAINGCNLFGekGasws 264  fruit fly
Q9EWZ6  367 -----AAHDRLTDEAeraAAVAVDVVERQWLKPEAGLWE-----LEDRWWT-----HSRLSVVCGLRRMAEVLpgA---- 427  Streptomyces coelic...
Q97V93  352 TND--QVFLKDVFSK---VKYIGDWISENWSLKDSGIWE----DRGSPQHYthSKIMMWIALDKIGKLANLIG------- 415  Sulfolobus solfatar...
Q9RJ38  358 LAG--MRPRPQMWEL---QCALMEFLATAWREPDEGLWE----VRGGRRQFvhSKVMTWVALDRAVRTLEDRPelG---- 424  Streptomyces coelic...
Q9S223  373 MTG--LARNDYASVL---QLKLIRYLEDHWNEPDEGIWE----VRGPRRHFvhSKVMAWVAVDRTIKLIESGDadG---- 439  Streptomyces coelic...
Q9KYJ7  364 QSG--VAHCADTAVL---HRQLIQHLARRWREPDEGIWE----IRGARRHFvhSKVMAWVAVDRTIRLAEAGAldM---- 430  Streptomyces coelic...
Q10211  400 KKC--QPIAYDLWLE---VRQICDYVCANWKRPDKSIWE----VRGQERNFlySKIMLWVALDRALRIAFTRSlpC---- 466  Schizosaccharomyces...
Q9W391  150 ASG--LQIVFSLDEVs-fIQNLVFYIESAYSIPDYGIWErgdkTNHGEPELnaSSIGMAKAALEAMNELDLFGarGgpas 226  fruit fly
Q8YW30  153 ASG--LQIIYTIDEVn-fVQNLVYYIGRAYRTPDYGIWErgnkINHGNAELnaSSVGMAKAALEAMNELDLFGvrGsqas 229  Nostoc sp. PCC 7120
Q9VLS1  188 TSG--LQIIYTHDEVa-fVQNLVYYVERAYRTPDFGMWErgskYNNGTPEIhaSSIGMAKSALEAINGCNLFGekGasws 264  fruit fly
Q9EWZ6  367 -----AAHDRLTDEAeraAAVAVDVVERQWLKPEAGLWE-----LEDRWWT-----HSRLSVVCGLRRMAEVLpgA---- 427  Streptomyces coelic...
Q97V93  352 TND--QVFLKDVFSK---VKYIGDWISENWSLKDSGIWE----DRGSPQHYthSKIMMWIALDKIGKLANLIG------- 415  Sulfolobus solfatar...
Q9RJ38  358 LAG--MRPRPQMWEL---QCALMEFLATAWREPDEGLWE----VRGGRRQFvhSKVMTWVALDRAVRTLEDRPelG---- 424  Streptomyces coelic...
Q9S223  373 MTG--LARNDYASVL---QLKLIRYLEDHWNEPDEGIWE----VRGPRRHFvhSKVMAWVAVDRTIKLIESGDadG---- 439  Streptomyces coelic...
Q9KYJ7  364 QSG--VAHCADTAVL---HRQLIQHLARRWREPDEGIWE----IRGARRHFvhSKVMAWVAVDRTIRLAEAGAldM---- 430  Streptomyces coelic...
Q10211  400 KKC--QPIAYDLWLE---VRQICDYVCANWKRPDKSIWE----VRGQERNFlySKIMLWVALDRALRIAFTRSlpC---- 466  Schizosaccharomyces...
3EQA_A  209 ---------------------------------------------SCSW--CDSQAPEILCYL-------Q----SF--- 227  Aspergillus niger
Q9W391  227 vihvladeahkcqavlqsmlpresnskeldsgllcvigfpafavdDAQL--IHNTKDAILSRLqgkygckRflrdGYrtp 304  fruit fly
Q8YW30  230 vihvlpdeiartrstlesllpresaskeidaallsiisypafaveDAQL--RERTLNEIINKLqgkygckRflrdGHqtv 307  Nostoc sp. PCC 7120
Q9VLS1  265 vvyvdidahnrnrsifetmlpressskgvdasllltlsfpafashEDRL--VEQTKQNVVNRLrckmgfkRftrdGFlsk 342  fruit fly
Q9EWZ6  428 ---------------------------------------------AGRR--CADLADTVLRETr------R----RC--- 447  Streptomyces coelic...
Q97V93  416 ---------------------------------------------YADI--WAKEREKLRNWIftn--cvKn-------- 438  Sulfolobus solfatar...
Q9RJ38  425 ---------------------------------------------GGDLdgWRALRDEVHREVc-----eK----GY--- 447  Streptomyces coelic...
Q9S223  440 ---------------------------------------------PLER--WKQLRDDIHRDVc-----eK----GY--- 460  Streptomyces coelic...
Q9KYJ7  431 ---------------------------------------------DVAP--LVELRAAIHREVc-----dK----GF--- 451  Streptomyces coelic...
Q10211  467 ---------------------------------------------PKHMv-WMDTRDEIYEAIm-----dS----GY--- 488  Schizosaccharomyces...
Q9W391  227 vihvladeahkcqavlqsmlpresnskeldsgllcvigfpafavdDAQL--IHNTKDAILSRLqgkygckRflrdGYrtp 304  fruit fly
Q8YW30  230 vihvlpdeiartrstlesllpresaskeidaallsiisypafaveDAQL--RERTLNEIINKLqgkygckRflrdGHqtv 307  Nostoc sp. PCC 7120
Q9VLS1  265 vvyvdidahnrnrsifetmlpressskgvdasllltlsfpafashEDRL--VEQTKQNVVNRLrckmgfkRftrdGFlsk 342  fruit fly
Q9EWZ6  428 ---------------------------------------------AGRR--CADLADTVLRETr------R----RC--- 447  Streptomyces coelic...
Q97V93  416 ---------------------------------------------YADI--WAKEREKLRNWIftn--cvKn-------- 438  Sulfolobus solfatar...
Q9RJ38  425 ---------------------------------------------GGDLdgWRALRDEVHREVc-----eK----GY--- 447  Streptomyces coelic...
Q9S223  440 ---------------------------------------------PLER--WKQLRDDIHRDVc-----eK----GY--- 460  Streptomyces coelic...
Q9KYJ7  431 ---------------------------------------------DVAP--LVELRAAIHREVc-----dK----GF--- 451  Streptomyces coelic...
Q10211  467 ---------------------------------------------PKHMv-WMDTRDEIYEAIm-----dS----GY--- 488  Schizosaccharomyces...
3EQA_A  228 -----------------------WT--GSFILANFD---------SSRSGKDANT--------------LLGSIHTFDPE 259  Aspergillus niger
Q9W391  305 kedpsrlyyerwelrmfenieceWPlfYCYLILFHAfqsdkraveEYASRLEKIMvrse-------dgiLLVPESYAVPQ 377  fruit fly
Q8YW30  308 ledtqrlhyepwelkqfehieceWPlfFTYLALDGLfcddskqaqFYQEQLEKLLierdgvsanighslRLLPELYYVPA 387  Nostoc sp. PCC 7120
Q9VLS1  343 nedksrryyhsgelkefegleceWPlfFIAMIIDGVfknnneqieEFQNDLRRCLrtd--------vngDPVVTMYYAPD 414  fruit fly
Q9EWZ6  448 -----------------------LHadGRWRRAEDD------------DGPEAAL---------------LVPMARGCTF 477  Streptomyces coelic...
Q97V93  439 ---------------------------NYFIRYCGN-----------TDDVDSSL--------------LSAPLYGFIEV 466  Sulfolobus solfatar...
Q9RJ38  448 -----------------------DPvrNTFTQYYGS------------RELDASV--------------LLIPRVGFLPP 478  Streptomyces coelic...
Q9S223  461 -----------------------DKerNTFTQSYGS------------QALDASL--------------LLIPQMGFLPP 491  Streptomyces coelic...
Q9KYJ7  452 -----------------------DPvrNTFTQAYGS------------QELDAAT--------------LLIPRTGFLPP 482  Streptomyces coelic...
Q10211  489 -----------------------NMekGFFAQSFEN-----------NDILDASV--------------LVMPLVSFISP 520  Schizosaccharomyces...
Q9W391  305 kedpsrlyyerwelrmfenieceWPlfYCYLILFHAfqsdkraveEYASRLEKIMvrse-------dgiLLVPESYAVPQ 377  fruit fly
Q8YW30  308 ledtqrlhyepwelkqfehieceWPlfFTYLALDGLfcddskqaqFYQEQLEKLLierdgvsanighslRLLPELYYVPA 387  Nostoc sp. PCC 7120
Q9VLS1  343 nedksrryyhsgelkefegleceWPlfFIAMIIDGVfknnneqieEFQNDLRRCLrtd--------vngDPVVTMYYAPD 414  fruit fly
Q9EWZ6  448 -----------------------LHadGRWRRAEDD------------DGPEAAL---------------LVPMARGCTF 477  Streptomyces coelic...
Q97V93  439 ---------------------------NYFIRYCGN-----------TDDVDSSL--------------LSAPLYGFIEV 466  Sulfolobus solfatar...
Q9RJ38  448 -----------------------DPvrNTFTQYYGS------------RELDASV--------------LLIPRVGFLPP 478  Streptomyces coelic...
Q9S223  461 -----------------------DKerNTFTQSYGS------------QALDASL--------------LLIPQMGFLPP 491  Streptomyces coelic...
Q9KYJ7  452 -----------------------DPvrNTFTQAYGS------------QELDAAT--------------LLIPRTGFLPP 482  Streptomyces coelic...
Q10211  489 -----------------------NMekGFFAQSFEN-----------NDILDASV--------------LVMPLVSFISP 520  Schizosaccharomyces...
3EQA_A  260 AacddstfqpcS-------------------PRALANHKEVVDS-FRSIYTLNDGLSDSeavAVGR-YPEDTYY------ 312  Aspergillus niger
Q9W391  378 D----------LvgfeyqkpgsqvrevvgrcPFLWGQSLFILGR-LLQEGFLAVGELDP---LNRR-LGAQKKPdvvvqv 442  fruit fly
Q8YW30  388 E----------NveaeklapqtqprlpnenvPLVWAQSLYYLGQ-MLSEGLLAVGDVDP---LGRH-LTIGKKRealvqi 452  Nostoc sp. PCC 7120
Q9VLS1  415 G----------Dgsymr---------apsqsLFLWGQSFFIIAQ-LLTAGLLHINELDP----IRRyLPSYNRPrragry 470  fruit fly
Q9EWZ6  478 E----------D-------------------DGDAATRAYVESR-LSEDGY------------LYR-FEHPGVPlg---- 510  Streptomyces coelic...
Q97V93  467 S----------D-------------------STFINTLTKIEND-LKTDVF------------VKR-YKTDFmg------ 497  Sulfolobus solfatar...
Q9RJ38  479 D----------D-------------------PRVVGTVDAIGAE-LARDGL------------VRR-YSTEGDPvdg--- 512  Streptomyces coelic...
Q9S223  492 D----------D-------------------KRVIGTIEAIQRElSTSDGF------------ILR-YPTDGEAegvd-- 527  Streptomyces coelic...
Q9KYJ7  483 D----------D-------------------PRVIGTVDAVRRE-LSTD----DGL-------VYR-YPTCSEDagad-- 518  Streptomyces coelic...
Q10211  521 T----------D-------------------PRFLSTMDNIMKP-LEKDGLMSNGL-------IFR-YNNFVYEdgv--- 559  Schizosaccharomyces...
Q9W391  378 D----------LvgfeyqkpgsqvrevvgrcPFLWGQSLFILGR-LLQEGFLAVGELDP---LNRR-LGAQKKPdvvvqv 442  fruit fly
Q8YW30  388 E----------NveaeklapqtqprlpnenvPLVWAQSLYYLGQ-MLSEGLLAVGDVDP---LGRH-LTIGKKRealvqi 452  Nostoc sp. PCC 7120
Q9VLS1  415 G----------Dgsymr---------apsqsLFLWGQSFFIIAQ-LLTAGLLHINELDP----IRRyLPSYNRPrragry 470  fruit fly
Q9EWZ6  478 E----------D-------------------DGDAATRAYVESR-LSEDGY------------LYR-FEHPGVPlg---- 510  Streptomyces coelic...
Q97V93  467 S----------D-------------------STFINTLTKIEND-LKTDVF------------VKR-YKTDFmg------ 497  Sulfolobus solfatar...
Q9RJ38  479 D----------D-------------------PRVVGTVDAIGAE-LARDGL------------VRR-YSTEGDPvdg--- 512  Streptomyces coelic...
Q9S223  492 D----------D-------------------KRVIGTIEAIQRElSTSDGF------------ILR-YPTDGEAegvd-- 527  Streptomyces coelic...
Q9KYJ7  483 D----------D-------------------PRVIGTVDAVRRE-LSTD----DGL-------VYR-YPTCSEDagad-- 518  Streptomyces coelic...
Q10211  521 T----------D-------------------PRFLSTMDNIMKP-LEKDGLMSNGL-------IFR-YNNFVYEdgv--- 559  Schizosaccharomyces...
3EQA_A  313 ------------------------------------------------------------------NGNPW--------- 317  Aspergillus niger
Q9W391  443 viiaedneirdklaehdlhvqti--------------aevapievqparvlshlytylgrnrklglSGRKSrdvgilsts 508  fruit fly
Q8YW30  453 vllaededlqaqlavhgietqtp--------------kqvapiqvrqaselstiytqigrndklglTGRPVrrlrsltts 518  Nostoc sp. PCC 7120
Q9VLS1  471 safqgtatdlvvqivliaesmrlqammatygiqtqtphevepvqiwsstelikvyqhlgvnnkvglSGRPCrpvgslgts 550  fruit fly
Q9EWZ6  511 -----------------------------------------------------------------eAEGAF--------- 516  Streptomyces coelic...
Q97V93  498 -----------------------------------------------------------------eAKHPF--------- 503  Sulfolobus solfatar...
Q9RJ38  513 ---------------------------------------------------------------lpgGEGTF--------- 520  Streptomyces coelic...
Q9S223  528 --------------------------------------------------------------glpgDEGAF--------- 536  Streptomyces coelic...
Q9KYJ7  519 --------------------------------------------------------------gltgDEGAF--------- 527  Streptomyces coelic...
Q10211  560 ----------------------------------------------------------------ggDEGAF--------- 566  Schizosaccharomyces...
Q9W391  443 viiaedneirdklaehdlhvqti--------------aevapievqparvlshlytylgrnrklglSGRKSrdvgilsts 508  fruit fly
Q8YW30  453 vllaededlqaqlavhgietqtp--------------kqvapiqvrqaselstiytqigrndklglTGRPVrrlrsltts 518  Nostoc sp. PCC 7120
Q9VLS1  471 safqgtatdlvvqivliaesmrlqammatygiqtqtphevepvqiwsstelikvyqhlgvnnkvglSGRPCrpvgslgts 550  fruit fly
Q9EWZ6  511 -----------------------------------------------------------------eAEGAF--------- 516  Streptomyces coelic...
Q97V93  498 -----------------------------------------------------------------eAKHPF--------- 503  Sulfolobus solfatar...
Q9RJ38  513 ---------------------------------------------------------------lpgGEGTF--------- 520  Streptomyces coelic...
Q9S223  528 --------------------------------------------------------------glpgDEGAF--------- 536  Streptomyces coelic...
Q9KYJ7  519 --------------------------------------------------------------gltgDEGAF--------- 527  Streptomyces coelic...
Q10211  560 ----------------------------------------------------------------ggDEGAF--------- 566  Schizosaccharomyces...
3EQA_A  318 ----------------------------------------FLCTLA---------------------------------- 323  Aspergillus niger
Q9W391  509 klyslkdrifaftpqfadlsrfyiasdnelmidilkgeinFLKSAWdllgrplvtlvlkrihldqdkiplamiqtmrklk 588  fruit fly
Q8YW30  519 rvfrlrgetivflpsfldsqqfyltldyhflvdqirselaYIQKYWsdlgrpiltlmlthtmletgsqallelmqelkdg 598  Nostoc sp. PCC 7120
Q9VLS1  551 kvyricgmtvlcyplifevsdfylyrdmalliddiktelqFVGKYWrlsgrptvcllireehmrdpqfkemldllamlkk 630  fruit fly
Q9EWZ6  517 ----------------------------------------LLCGFA---------------------------------- 522  Streptomyces coelic...
Q97V93  504 ----------------------------------------LLTTVW---------------------------------- 509  Sulfolobus solfatar...
Q9RJ38  521 ----------------------------------------LVCSFW---------------------------------- 526  Streptomyces coelic...
Q9S223  537 ----------------------------------------LACSFW---------------------------------- 542  Streptomyces coelic...
Q9KYJ7  528 ----------------------------------------FLCAFW---------------------------------- 533  Streptomyces coelic...
Q10211  567 ----------------------------------------TMVCFW---------------------------------- 572  Schizosaccharomyces...
Q9W391  509 klyslkdrifaftpqfadlsrfyiasdnelmidilkgeinFLKSAWdllgrplvtlvlkrihldqdkiplamiqtmrklk 588  fruit fly
Q8YW30  519 rvfrlrgetivflpsfldsqqfyltldyhflvdqirselaYIQKYWsdlgrpiltlmlthtmletgsqallelmqelkdg 598  Nostoc sp. PCC 7120
Q9VLS1  551 kvyricgmtvlcyplifevsdfylyrdmalliddiktelqFVGKYWrlsgrptvcllireehmrdpqfkemldllamlkk 630  fruit fly
Q9EWZ6  517 ----------------------------------------LLCGFA---------------------------------- 522  Streptomyces coelic...
Q97V93  504 ----------------------------------------LLTTVW---------------------------------- 509  Sulfolobus solfatar...
Q9RJ38  521 ----------------------------------------LVCSFW---------------------------------- 526  Streptomyces coelic...
Q9S223  537 ----------------------------------------LACSFW---------------------------------- 542  Streptomyces coelic...
Q9KYJ7  528 ----------------------------------------FLCAFW---------------------------------- 533  Streptomyces coelic...
Q10211  567 ----------------------------------------TMVCFW---------------------------------- 572  Schizosaccharomyces...
3EQA_A      --------------------------------------------------------------------------------      Aspergillus niger
Q9W391  589 sgyingtrvmlgslkdflntsaitdlsflgstedgypdrlhpdvqtyldehllrsfsnrstmnlrggqlrprtlrrrmsc 668  fruit fly
Q8YW30  599 vcngvavklgrlnqlmltgaiqridflqdvefyqsavqd----------------------------------------- 637  Nostoc sp. PCC 7120
Q9VLS1  631 gycdgmkvrigrlqnlisssciehldfmnqsdltdnenaf---------------------------------------- 670  fruit fly
Q9EWZ6      --------------------------------------------------------------------------------      Streptomyces coelic...
Q97V93      --------------------------------------------------------------------------------      Sulfolobus solfatar...
Q9RJ38      --------------------------------------------------------------------------------      Streptomyces coelic...
Q9S223      --------------------------------------------------------------------------------      Streptomyces coelic...
Q9KYJ7      --------------------------------------------------------------------------------      Streptomyces coelic...
Q10211      --------------------------------------------------------------------------------      Schizosaccharomyces...
Q9W391  589 sgyingtrvmlgslkdflntsaitdlsflgstedgypdrlhpdvqtyldehllrsfsnrstmnlrggqlrprtlrrrmsc 668  fruit fly
Q8YW30  599 vcngvavklgrlnqlmltgaiqridflqdvefyqsavqd----------------------------------------- 637  Nostoc sp. PCC 7120
Q9VLS1  631 gycdgmkvrigrlqnlisssciehldfmnqsdltdnenaf---------------------------------------- 670  fruit fly
Q9EWZ6      --------------------------------------------------------------------------------      Streptomyces coelic...
Q97V93      --------------------------------------------------------------------------------      Sulfolobus solfatar...
Q9RJ38      --------------------------------------------------------------------------------      Streptomyces coelic...
Q9S223      --------------------------------------------------------------------------------      Streptomyces coelic...
Q9KYJ7      --------------------------------------------------------------------------------      Streptomyces coelic...
Q10211      --------------------------------------------------------------------------------      Schizosaccharomyces...
3EQA_A      --------------------------------------------------------------------------------      Aspergillus niger
Q9W391  669 kgaikktrsinvdsdnlgmegpsplterrlssivpppwlqankqshvsvfattpeegptssplslgndlireniypvdph 748  fruit fly
Q8YW30      --------------------------------------------------------------------------------      Nostoc sp. PCC 7120
Q9VLS1      --------------------------------------------------------------------------------      fruit fly
Q9EWZ6      --------------------------------------------------------------------------------      Streptomyces coelic...
Q97V93      --------------------------------------------------------------------------------      Sulfolobus solfatar...
Q9RJ38      --------------------------------------------------------------------------------      Streptomyces coelic...
Q9S223      --------------------------------------------------------------------------------      Streptomyces coelic...
Q9KYJ7      --------------------------------------------------------------------------------      Streptomyces coelic...
Q10211      --------------------------------------------------------------------------------      Schizosaccharomyces...
Q9W391  669 kgaikktrsinvdsdnlgmegpsplterrlssivpppwlqankqshvsvfattpeegptssplslgndlireniypvdph 748  fruit fly
Q8YW30      --------------------------------------------------------------------------------      Nostoc sp. PCC 7120
Q9VLS1      --------------------------------------------------------------------------------      fruit fly
Q9EWZ6      --------------------------------------------------------------------------------      Streptomyces coelic...
Q97V93      --------------------------------------------------------------------------------      Sulfolobus solfatar...
Q9RJ38      --------------------------------------------------------------------------------      Streptomyces coelic...
Q9S223      --------------------------------------------------------------------------------      Streptomyces coelic...
Q9KYJ7      --------------------------------------------------------------------------------      Streptomyces coelic...
Q10211      --------------------------------------------------------------------------------      Schizosaccharomyces...
3EQA_A      --------------------------------------------------------------------------------      Aspergillus niger
Q9W391  749 hsrsaidrrsefvrqqempkiliqrhraetnfadteveeliamlretenleeqgdilqylvdtqgldfntaglgfknkse 828  fruit fly
Q8YW30  638 --------------------------agkrcyylayhpgknwrlghsqefqveyetnldfllsslrasenlyeqiellqt 691  Nostoc sp. PCC 7120
Q9VLS1  671 --------------------------sqinheyigyqsltdvpkaltyveekisvahfdtkptpdiinalrstdsiyclc 724  fruit fly
Q9EWZ6      --------------------------------------------------------------------------------      Streptomyces coelic...
Q97V93      --------------------------------------------------------------------------------      Sulfolobus solfatar...
Q9RJ38      --------------------------------------------------------------------------------      Streptomyces coelic...
Q9S223      --------------------------------------------------------------------------------      Streptomyces coelic...
Q9KYJ7      --------------------------------------------------------------------------------      Streptomyces coelic...
Q10211      --------------------------------------------------------------------------------      Schizosaccharomyces...
Q9W391  749 hsrsaidrrsefvrqqempkiliqrhraetnfadteveeliamlretenleeqgdilqylvdtqgldfntaglgfknkse 828  fruit fly
Q8YW30  638 --------------------------agkrcyylayhpgknwrlghsqefqveyetnldfllsslrasenlyeqiellqt 691  Nostoc sp. PCC 7120
Q9VLS1  671 --------------------------sqinheyigyqsltdvpkaltyveekisvahfdtkptpdiinalrstdsiyclc 724  fruit fly
Q9EWZ6      --------------------------------------------------------------------------------      Streptomyces coelic...
Q97V93      --------------------------------------------------------------------------------      Sulfolobus solfatar...
Q9RJ38      --------------------------------------------------------------------------------      Streptomyces coelic...
Q9S223      --------------------------------------------------------------------------------      Streptomyces coelic...
Q9KYJ7      --------------------------------------------------------------------------------      Streptomyces coelic...
Q10211      --------------------------------------------------------------------------------      Schizosaccharomyces...
3EQA_A  324 -------------------AAEQLYDALYQWDKQGS-LEVTDVSLDFFKALYSDa--------------aTGTYSSSSST 369  Aspergillus niger
Q9W391  829 enatpnannagmleegrvvTVRDLLKGLYEKACQQKlWGLVRHTAGMLGKRVEDlakavtdl-lvrqkqvTVGMPPNNEH 907  fruit fly
Q8YW30  692 ltrlqglefdtgfgtnqrvTVADLLDEVYTKAGELGfWAVVRRAAG-LRQMVDIgltdavtsilirgkqiAVGRAYSEAS 770  Nostoc sp. PCC 7120
Q9VLS1  725 qlwgiilnregphfevnglNVNTALTQLYHRAGSLRyWRAVRYCSSLLHHIVDSispfittv-lvngkelTVGIIGQKET 803  fruit fly
Q9EWZ6  523 ------------------------MALATHRVGDRV------DAFRWFERTRAA-------------------------- 546  Streptomyces coelic...
Q97V93  510 ------------------------LARVYMRLGK------IDSAIEILNKINKV-------------------------- 533  Sulfolobus solfatar...
Q9RJ38  527 ------------------------YADALHATGR------TKEARELFERLVGL-------------------------- 550  Streptomyces coelic...
Q9S223  543 ------------------------MADDLAMIGR------VDEARKLFEKLLSL-------------------------- 566  Streptomyces coelic...
Q9KYJ7  534 ------------------------FVDGLALTGR------LDEARALFERLLAL-------------------------- 557  Streptomyces coelic...
Q10211  573 ------------------------LVEALAMAGCSGyPKLLSTAVSMFEDLVRY-------------------------- 602  Schizosaccharomyces...
Q9W391  829 enatpnannagmleegrvvTVRDLLKGLYEKACQQKlWGLVRHTAGMLGKRVEDlakavtdl-lvrqkqvTVGMPPNNEH 907  fruit fly
Q8YW30  692 ltrlqglefdtgfgtnqrvTVADLLDEVYTKAGELGfWAVVRRAAG-LRQMVDIgltdavtsilirgkqiAVGRAYSEAS 770  Nostoc sp. PCC 7120
Q9VLS1  725 qlwgiilnregphfevnglNVNTALTQLYHRAGSLRyWRAVRYCSSLLHHIVDSispfittv-lvngkelTVGIIGQKET 803  fruit fly
Q9EWZ6  523 ------------------------MALATHRVGDRV------DAFRWFERTRAA-------------------------- 546  Streptomyces coelic...
Q97V93  510 ------------------------LARVYMRLGK------IDSAIEILNKINKV-------------------------- 533  Sulfolobus solfatar...
Q9RJ38  527 ------------------------YADALHATGR------TKEARELFERLVGL-------------------------- 550  Streptomyces coelic...
Q9S223  543 ------------------------MADDLAMIGR------VDEARKLFEKLLSL-------------------------- 566  Streptomyces coelic...
Q9KYJ7  534 ------------------------FVDGLALTGR------LDEARALFERLLAL-------------------------- 557  Streptomyces coelic...
Q10211  573 ------------------------LVEALAMAGCSGyPKLLSTAVSMFEDLVRY-------------------------- 602  Schizosaccharomyces...
3EQA_A  370 YSSIVDAVKTFADGFVSIVEThAASNGSMSEQYDKSDGEQLSARDLTWSYAALLTANN 427  Aspergillus niger
Q9W391  908 TITAPLPEVELRQLIHDAYGD-DESTAMLTQELMVYLAMFIRTEPQLFHEMLRLRVGL 964  fruit fly
Q8YW30  771 LISVPMPHNEIADKINHFCRE-DIRDRVLTQEVLIYLGILIRSQTESFQGLLTLRVGY 827  Nostoc sp. PCC 7120
Q9VLS1  804 VFDKPMTPAEIQNVMYTSVQPyDVIQAVLQQEVVLYCGRLIATNPSMFRGILKIRIGW 861  fruit fly
Q9EWZ6  547 ----------------------CGPAGLFAEEYDVRQRQLRGNLPQAFVHAMLLECSV 582  Streptomyces coelicolor
Q97V93  534 ----------------------SRELHLVGEHVDVEKGEFTGNFPQIFVHAQLVIAIK 569  Sulfolobus solfataricus
Q9RJ38  551 ----------------------ANDVGLLAEEYDPVAGHQLGNFPQAFSHVGLVNTAL 586  Streptomyces coelicolor
Q9S223  567 ----------------------RNDLGLLAEEWDPRLQRQVGNFPQAFSHVPLIDTAL 602  Streptomyces coelicolor
Q9KYJ7  558 ----------------------RNDLGLLAEEYDPVQQRQLGNFPQAFSHMGLIQSAL 593  Streptomyces coelicolor
Q10211  603 ----------------------SSHLQYYSEECSL-SSESLGNSPQAFSSIAAIAAAH 637  Schizosaccharomyces pombe 972h-
Q9W391  908 TITAPLPEVELRQLIHDAYGD-DESTAMLTQELMVYLAMFIRTEPQLFHEMLRLRVGL 964  fruit fly
Q8YW30  771 LISVPMPHNEIADKINHFCRE-DIRDRVLTQEVLIYLGILIRSQTESFQGLLTLRVGY 827  Nostoc sp. PCC 7120
Q9VLS1  804 VFDKPMTPAEIQNVMYTSVQPyDVIQAVLQQEVVLYCGRLIATNPSMFRGILKIRIGW 861  fruit fly
Q9EWZ6  547 ----------------------CGPAGLFAEEYDVRQRQLRGNLPQAFVHAMLLECSV 582  Streptomyces coelicolor
Q97V93  534 ----------------------SRELHLVGEHVDVEKGEFTGNFPQIFVHAQLVIAIK 569  Sulfolobus solfataricus
Q9RJ38  551 ----------------------ANDVGLLAEEYDPVAGHQLGNFPQAFSHVGLVNTAL 586  Streptomyces coelicolor
Q9S223  567 ----------------------RNDLGLLAEEWDPRLQRQVGNFPQAFSHVPLIDTAL 602  Streptomyces coelicolor
Q9KYJ7  558 ----------------------RNDLGLLAEEYDPVQQRQLGNFPQAFSHMGLIQSAL 593  Streptomyces coelicolor
Q10211  603 ----------------------SSHLQYYSEECSL-SSESLGNSPQAFSSIAAIAAAH 637  Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap