3KB6,2O4C,2Q50


Conserved Protein Domain Family
2-Hacid_dh

?
pfam00389: 2-Hacid_dh (this model, PSSM-Id:215893 is obsolete and has been replaced by 425656)
Click on image for an interactive view with Cn3D
D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain
This family represents the largest portion of the catalytic domain of 2-hydroxyacid dehydrogenases as the NAD binding domain is inserted within the structural domain.
Statistics
?
PSSM-Id: 215893
Aligned: 98 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Dec-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3KB6_B   3 VLFTSV---PQEDVPFYQEal--kDLSLKIYTtdvsKVPENELKK----AELISVFVYDKLTEELLSKX--PRLKLIHTR 71  Aquifex aeolicus
Q97U35   2 KIIS-----TEKVPDECKN-------IISVKD----ENITE---EdyknAEILLTWPGR-VNNDLIGKM--PNLKVIQTF 59  Sulfolobus solfataricus
Q9KEA4   2 NVVS-SarvRPEIQQELLD-------DYPNVHfhffERM-EIVGSaleeADVLITYGED-VTEEHLQAA--KKLKWIMVI 69  Bacillus halodurans
Q99T17   2 KVVGln--rMREVETELQQ-------RFSDLDfkfyKKASEIPESdladLDILVGYDGG-INEAFLQRC--PNLKWIAWF 69  Staphylococcus aureus...
P44501   3 IAIYST---KSYDRKYIELinakyNFDLEFFD----FMLNESTVRlaehCEVVCIFVNDNGSRKVLEKLaaLGVKIVALR 75  Haemophilus influenza...
Q9I530   3 ILFFSS---QAYDSESFQAsnhrhGFELHFQQ----AHLQADTAVlaqgFEVVCAFVNDDLSRPVLERLaaGGTRLVALR 75  Pseudomonas aeruginosa
P74586   3 IAFFSS---KAYDRQFFQQanhphQREMVFFD----AQLNLDTAIlaedCPVICLFVNDQAPAPVLEKLaaQGTKLIALR 75  Synechocystis sp. PCC...
P30799   3 VAIFSS---KNYDHHSIEKenehyGHDLVFLN----ERLTKETAEkakdAEAVCIFVNDEANAEVLEILagLGIKLVALR 75  Zymomonas mobilis
Q9P7Q1   3 VVLFSS---QSYDRGPFEEanktfNHEIIYHN----FSLNKDTVSlagkAQVVCVFVNDQVDADTLKALaeNGVKLVALR 75  Schizosaccharomyces p...
Q9P7P8   3 IAFFSA---QPYEKEPFEKvnenyKHEIDYHE----SILNKKTAVlaekAPVVCVFVNDKVDADTLKVLakNGTKLIALR 75  Schizosaccharomyces p...
Q97U35   2 KIIS-----TEKVPDECKN-------IISVKD----ENITE---EdyknAEILLTWPGR-VNNDLIGKM--PNLKVIQTF 59  Sulfolobus solfataricus
Q9KEA4   2 NVVS-SarvRPEIQQELLD-------DYPNVHfhffERM-EIVGSaleeADVLITYGED-VTEEHLQAA--KKLKWIMVI 69  Bacillus halodurans
Q99T17   2 KVVGln--rMREVETELQQ-------RFSDLDfkfyKKASEIPESdladLDILVGYDGG-INEAFLQRC--PNLKWIAWF 69  Staphylococcus aureus...
P44501   3 IAIYST---KSYDRKYIELinakyNFDLEFFD----FMLNESTVRlaehCEVVCIFVNDNGSRKVLEKLaaLGVKIVALR 75  Haemophilus influenza...
Q9I530   3 ILFFSS---QAYDSESFQAsnhrhGFELHFQQ----AHLQADTAVlaqgFEVVCAFVNDDLSRPVLERLaaGGTRLVALR 75  Pseudomonas aeruginosa
P74586   3 IAFFSS---KAYDRQFFQQanhphQREMVFFD----AQLNLDTAIlaedCPVICLFVNDQAPAPVLEKLaaQGTKLIALR 75  Synechocystis sp. PCC...
P30799   3 VAIFSS---KNYDHHSIEKenehyGHDLVFLN----ERLTKETAEkakdAEAVCIFVNDEANAEVLEILagLGIKLVALR 75  Zymomonas mobilis
Q9P7Q1   3 VVLFSS---QSYDRGPFEEanktfNHEIIYHN----FSLNKDTVSlagkAQVVCVFVNDQVDADTLKALaeNGVKLVALR 75  Schizosaccharomyces p...
Q9P7P8   3 IAFFSA---QPYEKEPFEKvnenyKHEIDYHE----SILNKKTAVlaekAPVVCVFVNDKVDADTLKVLakNGTKLIALR 75  Schizosaccharomyces p...
3KB6_B  72 SVGFDHIDLDYCKKKGILVTHIPAYSPESVAEHTFAXILTLVKRLKRIEDRVKKLNFSQDSEILARELNRLTLGVIGTGR 151 Aquifex aeolicus
Q97U35  60 SAGVDDLDFSIIPSH-VKVFSNAGAYSLSVAEHAWALILASAKGVGTKKRTIVYDVSEKTLLILGGGGIGSEVARIGKTA 138 Sulfolobus solfataricus
Q9KEA4  70 SAGVEQLPFQAIKEKGIIVTNAKGIHAIPMAEYTLSMMLQVARNAKRLISLEQEQTWDRRVPMIELNGQTVGVLGAGAIG 149 Bacillus halodurans
Q99T17  70 ATGVNTLPLDYIADHGILLTNGKGVQAKQLSEYILAFILDDYKKMKLSYDNQRQHIYDSKITGKRLSGQTVLFLGTGAIA 149 Staphylococcus aureus...
P44501  76 CAGFNNVDLKAAQELGIQVVRVPAYSPEAVAEHTIGLMMTLNRRIHRAYQRTREANFSLEGLIGFNMYGRTVGVIGTGKI 155 Haemophilus influenza...
Q9I530  76 SAGYNHVDLAAAEALGLPVVHVPAYSPHAVAEHAVGLILTLNRRLHRAYNRTREGDFSLHGLTGFDLHGKRVGVIGTGQI 155 Pseudomonas aeruginosa
P74586  76 SAGYNNVDLKTAADLGLKVVHVPSYSPHAVAEHTVGLILALNRKLYRAYNRVRDDNFSLEGLLGFDLHGTTVGVIGTGKI 155 Synechocystis sp. PCC...
P30799  76 CAGYNNVDLDAAKKLNIKVVRVPAYSPYSVAEYAVGMLLTLNRQISRGLKRVRENNFSLEGLIGLDVHDKTVGIIGVGHI 155 Zymomonas mobilis
Q9P7Q1  76 CGGYNNVNLKAASEYKITVVHVPSYSPFAVSEFTVGLLLSLNRKIHRAYVRVREDDFNIVGLLGCDIHGKTVGVIGTGKI 155 Schizosaccharomyces p...
Q9P7P8  76 CAGFNNVDLKAAADNGITVVRVPAYSPYAVAEYTIGLLLSLNRKIHRAYVRVREDDFNLNGLLGHDLHGKTIGLLGTGRI 155 Schizosaccharomyces p...
Q97U35  60 SAGVDDLDFSIIPSH-VKVFSNAGAYSLSVAEHAWALILASAKGVGTKKRTIVYDVSEKTLLILGGGGIGSEVARIGKTA 138 Sulfolobus solfataricus
Q9KEA4  70 SAGVEQLPFQAIKEKGIIVTNAKGIHAIPMAEYTLSMMLQVARNAKRLISLEQEQTWDRRVPMIELNGQTVGVLGAGAIG 149 Bacillus halodurans
Q99T17  70 ATGVNTLPLDYIADHGILLTNGKGVQAKQLSEYILAFILDDYKKMKLSYDNQRQHIYDSKITGKRLSGQTVLFLGTGAIA 149 Staphylococcus aureus...
P44501  76 CAGFNNVDLKAAQELGIQVVRVPAYSPEAVAEHTIGLMMTLNRRIHRAYQRTREANFSLEGLIGFNMYGRTVGVIGTGKI 155 Haemophilus influenza...
Q9I530  76 SAGYNHVDLAAAEALGLPVVHVPAYSPHAVAEHAVGLILTLNRRLHRAYNRTREGDFSLHGLTGFDLHGKRVGVIGTGQI 155 Pseudomonas aeruginosa
P74586  76 SAGYNNVDLKTAADLGLKVVHVPSYSPHAVAEHTVGLILALNRKLYRAYNRVRDDNFSLEGLLGFDLHGTTVGVIGTGKI 155 Synechocystis sp. PCC...
P30799  76 CAGYNNVDLDAAKKLNIKVVRVPAYSPYSVAEYAVGMLLTLNRQISRGLKRVRENNFSLEGLIGLDVHDKTVGIIGVGHI 155 Zymomonas mobilis
Q9P7Q1  76 CGGYNNVNLKAASEYKITVVHVPSYSPFAVSEFTVGLLLSLNRKIHRAYVRVREDDFNIVGLLGCDIHGKTVGVIGTGKI 155 Schizosaccharomyces p...
Q9P7P8  76 CAGFNNVDLKAAADNGITVVRVPAYSPYAVAEYTIGLLLSLNRKIHRAYVRVREDDFNLNGLLGHDLHGKTIGLLGTGRI 155 Schizosaccharomyces p...
3KB6_B 152 IGSRVAXYGLAFGXKVLCYDVVKREDLKEKGCVYTSLDELLKesdvislhvpytketHHXINEERISLXKDGVYLINTAR 231 Aquifex aeolicus
Q97U35 139 FRNYVIGISRSFKKPEWFDERHGMTMLREKIGEADIIV----------------------DTLPLNKQTRGLLSYDLLKD 196 Sulfolobus solfataricus
Q9KEA4 150 QEIARLAKAFRMKTIGMNSTGRTVSSFDQIVPPASVDTLLK----------------NSDFVVSVLPFTKRTEGFMTYER 213 Bacillus halodurans
Q99T17 150 TRTAKLAKAFNMNLIGLSKSGQNKDEFDEIYTIESLESTLP----------------NADIIINALPETQETIHLLKKKH 213 Staphylococcus aureus...
P44501 156 GIAVMRILKGFGMNILAYDPFKNPVVEELGGQYVELDELYAKshvitl---hcpatpENYHLLNCEAFAKMKDGVMIVNT 232 Haemophilus influenza...
Q9I530 156 GETFARIMAGFGCELLAYDPYPNPRIQALGGRYLALDALLAEsdivsl---hcpltaDTRHLIDAQRLATMKPGAMLINT 232 Pseudomonas aeruginosa
P74586 156 GLAFAQIMNGFGCHLLGYDAFPNDKFTAIGQALYVSLNELLAhsdiisl--hcpllpETHYLINTNTIAQMKPGVMLINT 233 Synechocystis sp. PCC...
P30799 156 GSVFAHIMTHGFGANVIAYKPHPDPELAKKVGFRFTSLDEVIetsdiis-lhcpltpENHHMINEETLARAKKGFYLVNT 234 Zymomonas mobilis
Q9P7Q1 156 GSNVAKCFKMGFGCDVLAYDINPDKKLENYGVQFVEQNEVLKkadflcl--hcpltpSTTHIVNSDSLALMKKGVTIVNT 233 Schizosaccharomyces p...
Q9P7P8 156 GGLVAKCLKLGFGCEVLAHDIKPNKELEKFGIQFVEQQEVLAkadflcl--hcpltpDTEHLVDEKLLASMKKGVKIINT 233 Schizosaccharomyces p...
Q97U35 139 FRNYVIGISRSFKKPEWFDERHGMTMLREKIGEADIIV----------------------DTLPLNKQTRGLLSYDLLKD 196 Sulfolobus solfataricus
Q9KEA4 150 QEIARLAKAFRMKTIGMNSTGRTVSSFDQIVPPASVDTLLK----------------NSDFVVSVLPFTKRTEGFMTYER 213 Bacillus halodurans
Q99T17 150 TRTAKLAKAFNMNLIGLSKSGQNKDEFDEIYTIESLESTLP----------------NADIIINALPETQETIHLLKKKH 213 Staphylococcus aureus...
P44501 156 GIAVMRILKGFGMNILAYDPFKNPVVEELGGQYVELDELYAKshvitl---hcpatpENYHLLNCEAFAKMKDGVMIVNT 232 Haemophilus influenza...
Q9I530 156 GETFARIMAGFGCELLAYDPYPNPRIQALGGRYLALDALLAEsdivsl---hcpltaDTRHLIDAQRLATMKPGAMLINT 232 Pseudomonas aeruginosa
P74586 156 GLAFAQIMNGFGCHLLGYDAFPNDKFTAIGQALYVSLNELLAhsdiisl--hcpllpETHYLINTNTIAQMKPGVMLINT 233 Synechocystis sp. PCC...
P30799 156 GSVFAHIMTHGFGANVIAYKPHPDPELAKKVGFRFTSLDEVIetsdiis-lhcpltpENHHMINEETLARAKKGFYLVNT 234 Zymomonas mobilis
Q9P7Q1 156 GSNVAKCFKMGFGCDVLAYDINPDKKLENYGVQFVEQNEVLKkadflcl--hcpltpSTTHIVNSDSLALMKKGVTIVNT 233 Schizosaccharomyces p...
Q9P7P8 156 GGLVAKCLKLGFGCEVLAHDIKPNKELEKFGIQFVEQQEVLAkadflcl--hcpltpDTEHLVDEKLLASMKKGVKIINT 233 Schizosaccharomyces p...
3KB6_B 232 GKVVDTDALYRAYQRGKFSGLGLDVFEDEEILILKKYTEGKATDKNLKILELACKDNVIITPHIAYY--TDKSLERIREE 309 Aquifex aeolicus
Q97U35 197 IRRNAIIVNVGRGETVDEEGIYKLLKERQDVRFGTDVFWRKNGKEDFYNTKLWELDNFTGTLHTAGAygNESIMKRAMLI 276 Sulfolobus solfataricus
Q9KEA4 214 FQLMKPSAVFINIGRGKTVKQTELLKALEEKAISHAVLDVFEEEPLEENHPFWTMDSVTVTPHLSGI--SRQYQPRAFAI 291 Bacillus halodurans
Q99T17 214 FELMKDEALFINIGRGSIVKEALLIEVLKSKVIRHAYLDVFENEPLKPNHELYELENVTITAHITGN--DYEAKYDLLDI 291 Staphylococcus aureus...
P44501 233 SRGSLIDTQAAIDALKQRKIGALGMDVYENERDLFFEDKSNEVIQDDIFRRLSSCHNVLLTGHQAFL--TEEALTNIADV 310 Haemophilus influenza...
Q9I530 233 GRGALVNAAALIEALKSGQLGYLGLDVYEEEADIFFEDRSDQPLQDDVLARLLSFPNVVVTAHQAFL--TREALAAIADT 310 Pseudomonas aeruginosa
P74586 234 SRGHLIDTQAVIQGIKSHKIGFLGIDVYEEEEELFFTDHSDTIIQDDTFQLLQSFPNVMITAHQGFF--THNALQTIAAT 311 Synechocystis sp. PCC...
P30799 235 SRGGLVDTKAVIKSLKAKHLGGYAADVYEEEGPLFFENHADDIIEDDILERLIAFPNVVFTGHQAFL--TKEALSNIAHS 312 Zymomonas mobilis
Q9P7Q1 234 SRGGLIDTKALVDAIDSGQVGGCAIDVYEGERNLFYKDLSNEVIKDSTFQRLVNFPNVLVTSHQAFF--TTEALCSIAHT 311 Schizosaccharomyces p...
Q9P7P8 234 SRGGLVDTKALVKAIESGQVGGCAMDVYEGERRLFYRDLSNEVIKDTTFQQLANFPNVLVTSHQAFF--TAEALSAIAHT 311 Schizosaccharomyces p...
Q97U35 197 IRRNAIIVNVGRGETVDEEGIYKLLKERQDVRFGTDVFWRKNGKEDFYNTKLWELDNFTGTLHTAGAygNESIMKRAMLI 276 Sulfolobus solfataricus
Q9KEA4 214 FQLMKPSAVFINIGRGKTVKQTELLKALEEKAISHAVLDVFEEEPLEENHPFWTMDSVTVTPHLSGI--SRQYQPRAFAI 291 Bacillus halodurans
Q99T17 214 FELMKDEALFINIGRGSIVKEALLIEVLKSKVIRHAYLDVFENEPLKPNHELYELENVTITAHITGN--DYEAKYDLLDI 291 Staphylococcus aureus...
P44501 233 SRGSLIDTQAAIDALKQRKIGALGMDVYENERDLFFEDKSNEVIQDDIFRRLSSCHNVLLTGHQAFL--TEEALTNIADV 310 Haemophilus influenza...
Q9I530 233 GRGALVNAAALIEALKSGQLGYLGLDVYEEEADIFFEDRSDQPLQDDVLARLLSFPNVVVTAHQAFL--TREALAAIADT 310 Pseudomonas aeruginosa
P74586 234 SRGHLIDTQAVIQGIKSHKIGFLGIDVYEEEEELFFTDHSDTIIQDDTFQLLQSFPNVMITAHQGFF--THNALQTIAAT 311 Synechocystis sp. PCC...
P30799 235 SRGGLVDTKAVIKSLKAKHLGGYAADVYEEEGPLFFENHADDIIEDDILERLIAFPNVVFTGHQAFL--TKEALSNIAHS 312 Zymomonas mobilis
Q9P7Q1 234 SRGGLIDTKALVDAIDSGQVGGCAIDVYEGERNLFYKDLSNEVIKDSTFQRLVNFPNVLVTSHQAFF--TTEALCSIAHT 311 Schizosaccharomyces p...
Q9P7P8 234 SRGGLVDTKALVKAIESGQVGGCAMDVYEGERRLFYRDLSNEVIKDTTFQQLANFPNVLVTSHQAFF--TAEALSAIAHT 311 Schizosaccharomyces p...
3KB6_B 310 TVKVVKAFVKGdleqikgNFVVG 332 Aquifex aeolicus
Q97U35 277 ACLNVKKYIDRgi----aDNEVR 295 Sulfolobus solfataricus
Q9KEA4 292 FRENFDSFIAGtp---plINRIN 311 Bacillus halodurans
Q99T17 292 FKNNLVNFLNKng---liENEVD 311 Staphylococcus aureus subsp. aureus Mu50
P44501 311 TLSNIYKLKSGkv----cENIVL 329 Haemophilus influenzae Rd KW20
Q9I530 311 TLDNIAAWQDGt-----pRNRVR 328 Pseudomonas aeruginosa
P74586 312 TLANIAEFEQNkp----lTYQVI 330 Synechocystis sp. PCC 6803
P30799 313 ILQDISDAEAGke----mPDALV 331 Zymomonas mobilis
Q9P7Q1 312 TLKSASDFYTNsl----dESVIA 330 Schizosaccharomyces pombe 972h-
Q9P7P8 312 TLKNVSDFASQnn----dPSVIV 330 Schizosaccharomyces pombe 972h-
Q97U35 277 ACLNVKKYIDRgi----aDNEVR 295 Sulfolobus solfataricus
Q9KEA4 292 FRENFDSFIAGtp---plINRIN 311 Bacillus halodurans
Q99T17 292 FKNNLVNFLNKng---liENEVD 311 Staphylococcus aureus subsp. aureus Mu50
P44501 311 TLSNIYKLKSGkv----cENIVL 329 Haemophilus influenzae Rd KW20
Q9I530 311 TLDNIAAWQDGt-----pRNRVR 328 Pseudomonas aeruginosa
P74586 312 TLANIAEFEQNkp----lTYQVI 330 Synechocystis sp. PCC 6803
P30799 313 ILQDISDAEAGke----mPDALV 331 Zymomonas mobilis
Q9P7Q1 312 TLKSASDFYTNsl----dESVIA 330 Schizosaccharomyces pombe 972h-
Q9P7P8 312 TLKNVSDFASQnn----dPSVIV 330 Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap