Conserved Protein Domain Family
HSP90

?
pfam00183: HSP90 (this model, PSSM-Id:215774 is obsolete and has been replaced by 425509)
Hsp90 protein
Statistics
?
PSSM-Id: 215774
Aligned: 11 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Dec-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P35016 259 EYLDEFKLKELVKRYSEFINFPIYLWASKEVEVEVPAEEDDSSDDEDNKSESSSSE----------EGeeEETEKEEDek 328 Madagascar periwinkle
P02828 184 DYLEESKIKEIVNKHSQFIGYPIKLLVEKEREKEVSDDEADDEKKEGDEKKEMETDepkie-dvgeDE--DADKKDKD-- 258 fruit fly
P11501 195 EYLEERRIKEIVKKHSQFIGYPIRLFVEKERDKEVSDDEAEEKEEEKEEKEEKTEDkpeie-dvgsDE--EEEKKDGD-- 269 chicken
P36181 184 EYLEERRLKDLIKKHSEFISYPISLWVEKTIEKEISDDEEEEEKKDEEg----------------kVEevD-EEKEKEe- 245 Solanum lycopersicum
P24724 190 EYLEERRLKELVKKHSEFISFPISLSVEKTQETEVTDDEAEL-DEDKKPEEEKPKDdkvedvtdekVTdvTDEEEKKEek 268 Theileria parva
P27741 181 EYLEARRLKELIKKHSEFIGYDIELMVEKTTEKEVTDEDE-EEAKKADEDGee------------pKVeeVTEGEEGk-- 245 Leishmania amazonensis
P41148 257 DYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMEEEEAAKEEKEDSDd-----------------eAAVEEEEEek 319 dog
P36183 259 EYLEEGKLKDLVKKYSEFINFPIYLWATKEVDVEVPADEEES-----NEEEESTTE----------TTeeEETE-DDEek 322 Hordeum vulgare
P41887 184 QYLEEKTIKDTVKKHSEFISYPIQLVVTREVEKEVPEEE---ETEEVKNEEddk----------apKIeeVDDESEKKe- 249 Schizosaccharomyces p...
P33125 183 EYLNESKIKEVVKKQSEFIFYPIYLHVLKENEKEVPDED----AEEVKDEGddk----------apKVeeVDEDEEDKtk 248 Ajellomyces capsulatus
P02829 183 EYLEEKRIKEVIKRHSEFVAYPIQLVVTKEVEKEVPIPEEEKKDEEKKDEEKKDEddk------kpKLeeVDEEEEk--- 253 Saccharomyces cerevis...
P35016 329 KPKTKKVKETTYEWELLNDMKAIWLRNPKDVTDDEYTKFYHSLAKDFSEekPLAWSHFTAEGDVEFKAFTLLPPKAPQDL 408 Madagascar periwinkle
P02828 259 AKKKKTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWED--HLAVKHFSVEGQLEFRALLFIPRRTPFDL 336 fruit fly
P11501 270 KKKKKKIKEKYIDEEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWED--HLAVKHFSVEGQLEFRALLFVPRRAPFDL 347 chicken
P36181 246 -kKKKKVKEVSNEWSLVNKQKPIWMRKPEEITKEEYAAFYKSLTNDWEE--HLAVKHFSVEGQLEFKAVLFVPKRAPFDL 322 Solanum lycopersicum
P24724 269 KKKKRKVTNVTREWEMLNKQKPIWMRLPSEVTNEEYAAFYKNLTNDWED--HLAVKHFSVEGQLEFKALLFVPRRAPFDM 346 Theileria parva
P27741 246 KKKTKKVKEVTKEYEVQNKHKPLWTRDPKDVTKEEYAAFYKAISNDWED--PPATKHFSVEGQLEFRAIMFVPKRAPFDM 323 Leishmania amazonensis
P41148 320 KPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEDDEYKAFYKSFSKESDD--PMAYIHFTAEGEVTFKSILFVPTSAPRGL 397 dog
P36183 323 KPKTKTVKETTTEWELLNDMKAVWLRSPKEVTEEEYAKFYHSLAKDFGDdkPMSWSHFSAEGDVEFKALLFVPPKAPHDL 402 Hordeum vulgare
P41887 250 -kKTKKVKETTTETEELNKTKPIWTRNPSEVTKEEYASFYKSLTNDWED--HLAVKHFSVEGQLEFRAILFVPRRAPMDL 326 Schizosaccharomyces p...
P33125 249 AKKTKKIKENKIEEEELNKTKPIWTRNPADITQEEYASFYK--TNDWED--HLAVKHFSVEGQLEFRAILFVPKRAPFDL 324 Ajellomyces capsulatus
P02829 254 KPKTKKVKEEVQEIEELNKTKPLWTRNPSDITQEEYNAFYKSISNDWED--PLYVKHFSVEGQLEFRAILFIPKRAPFDL 331 Saccharomyces cerevis...
P35016 409 YESYynSNKSNLKLYVRRVFISDEFDELLPKYLNFLKGLVDSDTLPLNVSREMLQQHSSLKTIKKKLIRKALDMIRKIAd 488 Madagascar periwinkle
P02828 337 FENQ--KKRNNIKLYVRRVFIMDNCEDLIPEYLNFMKGVVDSEDLPLNISREMLQQNKVLKVIRKNLVKKTMELIEELT- 413 fruit fly
P11501 348 FENR--KKKNNIKLYVRRVFIMDNCEELIPEYLNFMRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCLELFTELA- 424 chicken
P36181 323 FDTK--KKPNNIKLYVRRVFIMDNCDELIPEYLSFVKGIVDSEDLPLNISRETLQQNKILKVIRKNLVKKCVELFFEIA- 399 Solanum lycopersicum
P24724 347 FESR--KKKNNIKLYVRRVFIMDDCEELIPEWLSFVKGVVDSEDLPLNISRETLQQNKILKVIRKNLVKKCLELFNELT- 423 Theileria parva
P27741 324 LEPN--KKRNNIKLYVRRVFIMDNCEDLCPDWLGFVKGVVDSEDLPLNISRENLQQNKILKVIRKNIVKKCLEMFEEVA- 400 Leishmania amazonensis
P41148 398 FDEYgsKKSDYIKLYVRRVFITDDFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIA- 476 dog
P36183 403 YESYynANKSNLKLYVRRVFISDEFDDLLPKYLSFLMGIVDSDTLPLNVSREMLQQHSSLKTIKKKLIRKALDMIRKLAe 482 Hordeum vulgare
P41887 327 FEAK--RKKNNIKLYVRRVFITDDCEELIPEWLGFIKGVVDSEDLPLNLSREMLQQNKIMKVIRKNLVRRCLDMFNEIA- 403 Schizosaccharomyces p...
P33125 325 FETK--KTKNNIKLYVRRVFITDDATDLIPEWLSFIKGVVDSEDLPLGLSRETLQQNKIMKVIKN-IVKKTLELFNEIA- 400 Ajellomyces capsulatus
P02829 332 FESK--KKKNNIKLYVRRVFITDEAEDLIPEWLSFVKGVVDSEDLPLNLSREMLQQNKIMKVIRKNIVKKLIEAFNEIA- 408 Saccharomyces cerevis...
P35016 489 edpdeandkdkkeveestdndEKKGQYAKFWNEFGKSIKLGIIEDAANRNRLAKLLRFESTKSEGKLTSLDQYISRMKSG 568 Madagascar periwinkle
P02828 414 ---------------------EDKENYKKFYDQFSKNLKLGVHEDSNNRAKLADFLRFHTSASGDDFCSLADYVSRMKDN 472 fruit fly
P11501 425 ---------------------EDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKEN 483 chicken
P36181 400 ---------------------ENKEDYNKFYEAFSKNLKLGIHEDSQNRAKFAELLRYHSTKSGDEMTSLKDYVTRMKEG 458 Solanum lycopersicum
P24724 424 ---------------------EKKEDFKKFYEQFSKNLKLGIHEDNANRSKIAELLRFETTKSGDELVSLKEYVDRMKSD 482 Theileria parva
P27741 401 ---------------------ENKEDYKQFYEQFGKNIKLGIHEDTANRKKLMELLRFYSTESGEVMTTLKDYVTRMKAE 459 Leishmania amazonensis
P41148 477 ---------------------DEKYN-DTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPSDITSLDQYVERMKEK 534 dog
P36183 483 edpdeysnke-ktddeksameEKKGQYAKFWNEFGKSVKLGIIEDATNRNRLAKLLRFESSKSDGKLVSLDEYISRMKSG 561 Hordeum vulgare
P41887 404 ---------------------EDKENFKTFYDAFSKNLKLGIHEDAANRPALAKLLRYNSLNSPDDLISLEDYITKMPEH 462 Schizosaccharomyces p...
P33125 401 ---------------------EDREQFDKFYSAFSKNIKLGVHEDAQNRPALAKLLRYNSTKSGDETTSLTDYVTRMPEH 459 Ajellomyces capsulatus
P02829 409 ---------------------EDSEQFEKFYSAFSKNIKLGVHEDTQNRAALAKLLRYNSTKSVDELTSLTDYVTRMPEH 467 Saccharomyces cerevis...
P35016 569 QKDIFYITGTSKEQLEKSPFLERLTKKNYEVILFTDPVDEYLMQYLMDYEDKKFQNVSKEGLKIGK-DSK---DKELKES 644 Madagascar periwinkle
P02828 473 QKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHLKEYKGKQLVSVTKEGLELPEdESEkkkREEDKAK 552 fruit fly
P11501 484 QKHVYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEdEEEkkkQEEKKAK 563 chicken
P36181 459 QNDIYYITGESKKAVENSPFLEKLKKKGYEVLYMVDAIDEYSIGQLKEFEGKKLVSATKEGLKLDEsEDEkkkQEELKEK 538 Solanum lycopersicum
P24724 483 QKYVYYITGESKQSVASSPFLETLRARDYEVLYMTDPIDEYAVQQIKEFEGKKLKCCTKEGLDLDEgEDEkksFEALKEE 562 Theileria parva
P27741 460 QNSIYYITGDSKKKLESSPFIEQAKRRGFEVLFMTEPYDEYVMQQVKDFEDKKFACLTKEGVHFEEsEEEkrqREEEKAT 539 Leishmania amazonensis
P41148 535 QDKIYFMAGSSRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDEsEKTkesREAIEKE 614 dog
P36183 562 QKDIFYLTGSSKEQLEKSPFLEQLTKKNYEVIYFTDPVDEYLMQYLMDYEDKKFQNVSKEGLKLGK-DSK---LKDLKES 637 Hordeum vulgare
P41887 463 QKNIYFITGESKQAVENSPFLEIFRAKKFDVLFMVDPIDEYAVTQLKEFEGKKLVNITKDGLELEEtDEEkaaREKLEKE 542 Schizosaccharomyces p...
P33125 460 HKTIYYITGESLKAVQKSPFLDTLKEKNFEVLFLVDPNDEYAMTQLKEFDGKKLVDITKD-FELEEtEEEkkdREAEEKE 538 Ajellomyces capsulatus
P02829 468 QKNIYYITGESLKAVEKSPFLDALKAKNFEVLFLTDPIDEYAFTQLKEFEGKTLVDITKD-FELEEtDEEkaeREKEIKE 546 Saccharomyces cerevis...
P35016 645 FKELTKWWKGaLASENVDDVKISNRLANTPCVVVTSKYGWSSNMERIMQSQTLS---DASKQAYMRGKRVLEINPRHPII 721 Madagascar periwinkle
P02828 553 FESLCKLMKS-ILDNKVEKVVVSNRLVDSPCCIVTSQFGWSANMERIMKAQALR---DTATMGYMAGKKQLEINPDHPIV 628 fruit fly
P11501 564 FENLCKIMKD-ILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALR---DNSTMGYMAAKKHLEINPDHSII 639 chicken
P36181 539 FEGLCKVMKD-VLGDKVEKVIVSDRVVDSPCCLVTGEYGWTANMERIMKAQALR---DSSMAGYMSSKKTMEINPENSIM 614 Solanum lycopersicum
P24724 563 MEPLCKHIKE-VLHDKVEKVVCGTRFTDSPCALVTSEFGWSANMERIMKAQALR---DSSITSYMLSKKIMEINPRHSIM 638 Theileria parva
P27741 540 CEKLCKTMKE-VLGDKVEKVTVSERLSTSPCILVTSEFGWSAHMEQMMRNQALR---DSSMAQYMMSKKTMELNPKHPII 615 Leishmania amazonensis
P41148 615 FEPLLNWMKDkALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAYQtgkDISTNYYASQKKTFEINPRHPLI 694 dog
P36183 638 FKELTDWWKKaLDTEGIDSVKISNRLHNTPCVVVTSKYGWSSNMEKIMQAQTLS---DASKQAYMRGKRVLEINPRHPII 714 Hordeum vulgare
P41887 543 YEEFAKQLKT-ILGDKVEKVVVSNKIVGSPCLLTTGQYGWSANMERIMKAQALR---DTSMSAYMSSRKTFEINPKSPII 618 Schizosaccharomyces p...
P33125 539 YEGLAKSLEN-ILGDKVEKVVVSHKLIGSPCAIRTGQFGWSANMERIMKAQALR---DTSMSSRRSSR------------ 602 Ajellomyces capsulatus
P02829 547 YEPLTKALKE-ILGDQVEKVVVSYKLLDAPAAIRTGQFGWSANMERIMKAQALR---DSSMSSYMSSKKTFEISPKSPII 622 Saccharomyces cerevis...
P35016 722 KELRER-VVKDAEDESVKQTARLMYQTALMESGFMLNDPKEFASSIYDSVKSSLKISPDATVEEEDdtEEAEAESGTTES 800 Madagascar periwinkle
P02828 629 ETLRQK-ADADKNDKAVKDLVILLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGIDEDEPMTTDD--AQSAGDAPSLVE 705 fruit fly
P11501 640 ETLRQK-AEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDTAAEEA--SPAVTEEMPPLE 716 chicken
P36181 615 DELRKR-ADADKNDKSVKDLVLLLFETALLTSGFSLEEPNTFGNRIHRMLKLGLSIDE-ESG---D--ADADMPALEDPE 687 Solanum lycopersicum
P24724 639 KELKTR-AANDKTDKTVKDLVWLLYDTALLTSGFNLDEPTQFGNRIYRMIKLGLSLDDEEHV-EED-------SSMPPLD 709 Theileria parva
P27741 616 KELRRR-VEADENDKAVKDLVFLLFDTSLLTSGFQLEDPT-YAERINRMIKLGLSLDEEEEEE-A---VEAAVAETAPAE 689 Leishmania amazonensis
P41148 695 KDMLRR-VKEDEDDKTVSDLAVVLFETATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEP--EEEPEETTEDTT 771 dog
P36183 715 KELRDK-VAQDSDSEGLKQTARLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSPDAAVEEEEevEEPEVEEKESAK 793 Hordeum vulgare
P41887 619 AELKKKvEENGAEDRSVKDLATILYETALLSSGFTLDDPSAYAQRINRLISLGLSIDEEEEA------PIEEISTESVAA 692 Schizosaccharomyces p...
P33125 603 --------PTEGNDRTVKSITQLLFETSLLVSGFTIEEPSGFAGRIHKLVSLGLNIDED-----AE--TSEEKEADTVVA 667 Ajellomyces capsulatus
P02829 623 KELKKRvDEGGAQDKTVKDLTKLLYETALLTSGFSLDEPTSFASRINRLISLGLNIDEDEE---TE--TAPEASTAAPVE 697 Saccharomyces cerevis...
P35016 801 SAAEDAGAETLD 812 Madagascar periwinkle
P02828 706 DTEDASHMEEVD 717 fruit fly
P11501 717 GDDDTSRMEEVD 728 chicken
P36181 688 ADAEGSKMEEVD 699 Solanum lycopersicum
P24724 710 EPVVDSKMEEVD 721 Theileria parva
P27741 690 VTAGTSSMELVD 701 Leishmania amazonensis
P41148 772 EDTEQDDEEEMD 783 dog
P36183 794 QEAEEPEHEQYD 805 Hordeum vulgare
P41887 693 ENNAESKMEEVD 704 Schizosaccharomyces pombe 972h-
P33125 668 EAPADSDMEEVD 679 Ajellomyces capsulatus
P02829 698 EVPADTEMEEVD 709 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap