1KAO,1ZC4,3M1I,1S8F,1KY3,1Z0A,1Z0K,1UKV,2OCY,3QBT


Conserved Protein Domain Family
Ras

?
pfam00071: Ras (this model, PSSM-Id:215692 is obsolete and has been replaced by 333814)
Click on image for an interactive view with Cn3D
Ras family
Includes sub-families Ras, Rab, Rac, Ral, Ran, Rap Ypt1 and more. Shares P-loop motif with GTP_EFTU, arf and myosin_head. See pfam00009 pfam00025, pfam00063. As regards Rab GTPases, these are important regulators of vesicle formation, motility and fusion. They share a fold in common with all Ras GTPases: this is a six-stranded beta-sheet surrounded by five alpha-helices.
Statistics
?
PSSM-Id: 215692
View PSSM: pfam00071
Aligned: 61 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Dec-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1KAO_A   5 KVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNGQGFILVYSL 84  human
P32253   6 KLVIVGDGGVGKSALTIQLTQNQFIAEYDPTIENSYRKQVNIDEEVYMLDILDTAGQEEYSAMRDQYIRSGRGFLIVYSI 85  Dictyostelium discoideum
P01120  12 KLVVVGGGGVGKSALTIQLTQSHFVDEYDPTIEDSYRKQVVIDDEVSILDILDTAGQEEYSAMREQYMRNGEGFLLVYSI 91  Saccharomyces cerevis...
P22126  10 KLVVVGGGGVGKSCLTIQLIQGHFLDEYDPTIEDSYRKQCTIDNEVALLDILDTAGQEEYSAMREQYMRTGEGFLLVFAI 89  Neurospora crassa OR74A
P10301  31 KLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICSVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAI 110 human
P04388   7 KLVVVGGGGVGKSAITIQFIQSYFVTDYDPTIEDSYTKQCNIDDVPAKLDILDTAGQEEFSAMREQYMRSGEGFLLVFAL 86  fruit fly
P08647  10 KLVVVGDGGVGKSALTIQLIQSHFVDEYDPTIEDSYRKKCEIDGEGALLDVLDTAGQEEYSAMREQYMRTGEGFLLVYNI 89  Schizosaccharomyces p...
P32254   5 KLVLVGPGGVGKSCLTIQFIAQKFVDEYDPTLEDSYRKQTTVDGEECLLDIYDTAGQEDFSAVRDQYMRTGEGFLCVYSI 84  Dictyostelium discoideum
1ZC4_C   8 KVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGLEDYAAIRDNYFRSGEGFLCVFSI 87  human
P25378  18 KIALIGARNVGKTTLTVRFVESRFVESYYPTIENEFTRIIPYKSHDCTLEILDTAGQDEVSLLNIKSLTGVRGIILCYSI 97  Saccharomyces cerevis...
1KAO_A  85 VNQQSFQDIKPMRDQIIRVKRyeK-VPVILVGNKVDLES-----EREVSSSEGRALA-------EEWGCPFMETSAKSKT 151 human
P32253  86 ISRASFEAVTTFREQILRVKDlsT-YPIVIIGNKADLPDk----DRKVPPMEGKELA-------KSFGAPFLETSAKSRV 153 Dictyostelium discoideum
P01120  92 TSKSSLDELMTYYQQILRVKDtdY-VPIVVVGNKSDLEN-----EKQVSYQDGLNMA-------KQMNAPFLETSAKQAI 158 Saccharomyces cerevis...
P22126  90 NSRESFEEIRIYQQQILRVKDrdS-FPMIIVGNKYDLRG-----ERVVSEQEGQALA-------AEFGTKYIETSAKTQH 156 Neurospora crassa OR74A
P10301 111 NDRQSFNEVGKLFTQILRVKDrdD-FPVVLVGNKADLES-----QRQVPRSEASAFG-------ASHHVAYFEASAKLRL 177 human
P04388  87 NDHSSFDEIPKFQRQILRVKDrdE-FPMLMVGNKCDLKH-----QQQVSLEEAQNTS-------RNLMIPYIECSAKLRV 153 fruit fly
P08647  90 TSRSSFDEISTFYQQILRVKDkdT-FPVVLVANKCDLEA-----ERVVSRAEGEQLA-------KSMHCLYVETSAKLRL 156 Schizosaccharomyces p...
P32254  85 TYLQSFKEIHRLHNHLLKVKDldS-VPFVLVGNKCDLNE-----YREVSTAEGEELA-------KKLNCKFLETSAKERI 151 Dictyostelium discoideum
1ZC4_C  88 TEMESFAATADFREQILRVKEd-EnVPFLLVGNKSDLED-----KRQVSVEEAKNRA-------EQWNVNYVETSAKTRA 154 human
P25378  98 INRASFDLIPILWDKLVDQLGkdN-LPVILVGTKADLGRstkgvkRCVTKAEGEKLAstigsqdKRNQAAFIECSAELDY 176 Saccharomyces cerevis...
1KAO_A 152 MVDELFAEIVRQMNY 166 human
P32253 154 NVEEAFFTLVREIKR 168 Dictyostelium discoideum
P01120 159 NVEEAFYTLARLVRD 173 Saccharomyces cerevisiae S288c
P22126 157 NVENAFYDLVREIRK 171 Neurospora crassa OR74A
P10301 178 NVDEAFEQLVRAVRK 192 human
P04388 154 NVDQAFHELVRIVRK 168 fruit fly
P08647 157 NVEEAFYSLVRTIRR 171 Schizosaccharomyces pombe 972h-
P32254 152 NVSESFYELVREVKK 166 Dictyostelium discoideum
1ZC4_C 155 NVDKVFFDLMREIRA 169 human
P25378 177 NVEETFMLLLKQMER 191 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap