2ZIY,2KS9


Conserved Protein Domain Family
7tm_1

?
pfam00001: 7tm_1 (this model, PSSM-Id:215646 is obsolete and has been replaced by 394960)
Click on image for an interactive view with Cn3D
7 transmembrane receptor (rhodopsin family)
This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.
Statistics
?
PSSM-Id: 215646
Aligned: 66 rows
Threshold Bit Score: -1
Threshold Setting Gi: 0
Created: 21-Dec-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2ZIY_A  56 YLFTKTKSLQ-TPANMFIINLAFSDFTFSLVNGFPLMTISCFL-KkWIFGFAACKVYGFIGGIFGFMSIMTMAMISIDRY 133 Japanese flying squid
P30966  63 ATILKVRTFH-RVPHNLVASMAISDVLVAVLVMPLSLVHELSGrR-WQLGRRLCQLWIACDVLCCTASIWNVTAIALDRY 140 house mouse
P28222  72 ATVYRTRKLH-TPANYLIASLAVTDLLVSILVMPISTMYTVTg-R-WTLGQVVCDFWLSSDITCCTASILHLCVIALDRY 148 human
P21728  46 AAVIRFRHLRsKVTNFFVISLAVSDLLVAVLVMPWKAVAEIAG-F-WPFG-SFCNIWVAFDIMCSTASILNLCVISVDRY 122 human
P08588  81 VAIAKTPRLQ-TLTNLFIMSLASADLVMGLLVVPFGATIVVWg-R-WEYGSFFCELWTSVDVLCVTASIETLCVIALDRY 157 human
P31388  49 VLICTQPALR-NTSNFFLVSLFTSDLMVGLVVMPPAMLNALYG-R-WVLARGLCLLWTAFDVMCCSASILNLCLISLDRY 125 Norway rat
P25100 119 LSVACNRHLQ-TVTNYFIVNLAVADLLLSATVLPFSATMEVLG-F-WAFGRAFCDVWAAVDVLCCTASILSLCTISVDRY 195 human
P17124  41 LAVGLNRRLR-SLTNCFIVSLAITDLLLGLLVLPFSAFYQLSc-R-WSFGKVFCNIYTSLDVMLCTASILNLFMISLDRY 117 dog
P20288  57 MAVSREKALQ-TTTNYLIVSLAVADLLVATLVMPWVVYLEVVG-E-WKFSRIHCDIFVTLDVMMCTASILNLCAISIDRY 133 cattle
P18599  97 MAVSLEKKLQ-NATNYFLMSLAIADMLLGFLVMPVSMLTILYGyR-WPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRY 174 Chinese hamster
2ZIY_A 134 NVIGRPMAASKKMSh-RRAFIMIIFVWLWSVLWAIGPiFGwGAYTLE-Gv--LCNCSFDYISrDStt-----rSNILCMF 204 Japanese flying squid
P30966 141 WSITRHLEYTLRTRk-RVSNVMILLTWALSTVISLAPlLFgWGETYSeP---SEECQVSREP-S----------YTVFST 205 house mouse
P28222 149 WAITDAVEYSAKRTp-KRAAVMIALVWVFSISISLPP--FfWRQAKAeEe--vSECVVNTDH-IL---------YTVYST 213 human
P21728 123 WAISSPFRYERKMTp-KAAFILISVAWTLSVLISFIPvQLsWHKAKPtSp-sDGNATSLAET-IDncdsslsrTYAISSS 199 human
P08588 158 LAITSPFRYQSLLTr-ARARGLVCTVWAISALVSFLPiLMhWWRAESdE---ARRCYNDPKC-CDfvt---nrAYAIASS 229 human
P31388 126 LLILSPLRYKLRMTa-PRALALILGAWSLAALASFLPlLLgWHELGKaRtpaPGQCRLLASL-P----------FVLVAS 193 Norway rat
P25100 196 VGVRHSLKYPAIMTe-RKAAAILALLWVVALVVSVGP-LLgWKEPVPpD---ERFCGITEEA-G----------YAVFSS 259 human
P17124 118 CAVTDPLRYPVLITp-VRVAVSLVLIWVISITLSFLSiHLgWNSRNEtSs-fNHTIPKCKVQ-VNl-------VYGLVDG 187 dog
P20288 134 TAVAMPMLYNTRYSskRRVTVMIAIVWVLSFTISCPMlFG-LNNTDQnE------CIIANPA-F-----------VVYSS 194 cattle
P18599 175 VAIQNPIHHSRFNSr-TKAFLKIIAVWTISVGVSMPIpVFgLQDDSKvFk--QGSCLLADDN-F-----------VLIGS 239 Chinese hamster
2ZIY_A 205 ILGFFGPILIIFFCYFNIVMSVSNHEKEMAAmakrln------------------------------------------- 241 Japanese flying squid
P30966 206 VGAFYLPLCVVLFVYWKIYRAAKFRMGSRKTnsvspvpeavevknatqh------------------------------- 254 house mouse
P28222 214 VGAFYFPTLLLIALYGRIYVEARSRILKQTPnrtgkrltraqlitdspgstssvtsinsr-------------------- 273 human
P21728 200 VISFYIPVAIMIVTYTRIYRIAQKQIRRIAAleraavhakncqttt---------------------------------- 245 human
P08588 230 VVSFYVPLCIMAFVYLRVFREAQKQVKKIDScerrflggparppspspspvpapapp----------------------- 286 human
P31388 194 GVTFFLPSGAICFTYCRILLAARKQAVQVASlttgtagqaletlqvp--------------------------------- 240 Norway rat
P25100 260 VCSFYLPMAVIVVMYCRVYVVARSTTRSLEAgvkrergkasevvlrihcrgaat-------------------------- 313 human
P17124 188 LVTFYLPLLVMCITYYRIFKIARDQAKRIHHmg----------------------------------------------- 220 dog
P20288 195 IVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTkrssrafranlkaplkgncthpedmklctvimksngsfpvnrrrveaar 274 cattle
P18599 240 FVAFFIPLTIMVITYFLTIKSLQKEATLCVSdlstraklasfsflpqssls----------------------------- 290 Chinese hamster
2ZIY_A     --------------------------------------------------------------------------------     Japanese flying squid
P30966 255 ---------------------------------------------------------------------pqmvftvrhat 265 house mouse
P28222 274 -----------------------------------------------------------vpdvpsesgspvyvnqvkvrv 294 human
P21728 246 -------------------------------------------------------------------------gngkpve 252 human
P08588 287 --------------------------------------------------------------pgpprpaaaaataplang 304 human
P31388 241 ------------------------------------------------------------------------rtprpgme 248 Norway rat
P25100 314 -----------------------------------------------------------------gadgahgmrsakght 328 human
P17124     --------------------------------------------------------------------------------     dog
P20288 275 raqelememlsstsppertryspippshhqltlpdpshhglhstpdspakpeknghaktvnpkiakifeiqsmpngktrt 354 cattle
P18599 291 -------------------------------------------------------------------seklfqrsihrep 303 Chinese hamster
2ZIY_A 242 -akelrkAQAGANAEMRLAKISIVIVSQFLLSWSPYAVVALLAQFGPLEw-----VTPYAAQLPVMFAKASAIHNPMIY 314 Japanese flying squid
P30966 266 vtfqtegDTWREQKEQRAALMVGILIGVFVLCWFPFFVTELISPLCSWD------VPAIWKSIFLWLGYSNSFFNPLIY 338 house mouse
P28222 295 sdallekKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDAcw----fHLAIFDFFTWLGYLNSLINPIIY 369 human
P21728 253 csqpessFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCILPFCGSGetqpfcIDSNTFDVFVWFGWANSSLNPIIY 331 human
P08588 305 ragkrrpSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHREL------VPDRLFVFFNWLGYANSAFNPIIY 377 human
P31388 249 sadsrrlATKHSRKALKASLTLGILLGMFFVTWLPFFVANIAQAVCDCIs-------PGLFDVLTWLGYCNSTMNPIIY 320 Norway rat
P25100 329 frsslsvRLLKFSREKKAAKTLAIVVGVFVLCWFPFFFVLPLGSLFPQLk-----PSEGVFKVIFWLGYFNSCVNPLIY 402 human
P17124 221 ------sWKAATIGEHKATVTLAAVMGAFIICWFPYFTVFVYRGLKGDDa-----INEAFEAVVLWLGYANSALNPILY 288 dog
P20288 355 slktmsrRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCN------IPPVLYSAFTWLGYVNSAVNPIIY 427 cattle
P18599 304 gsytgrrTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKEScn--ehVIGALLNVFVWIGYLSSAVNPLVY 380 Chinese hamster
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap