Conserved Protein Domain Family
PLN02793

?
PLN02793: PLN02793 
Probable polygalacturonase
Statistics
?
PSSM-Id: 215426
Aligned: 5 rows
Threshold Bit Score: 783.297
Created: 9-Dec-2010
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18412685    1 MSYSRGGTLVTLLLLLVVASSLALTANANsFESLLQLPR-RQSRSTRPRSE-RLLHVGNFGAKGNGVTDDTK------AF 72 
224058683   1 MNNLRFGSCPKGTTTIRVLICACFVCVQG-FDSLLQLPQ-SAPARIRPSSK-RVLVVGDFGAKGDGLSNDTQachhytAF 77 
225442879   1 -------MESLCLICTVFIFLVLFLINVEgFEPLIQLPH---SPAARPRLEtKILYVNQFGAKGDGVQDDTD------AF 64 
255553121   1 -------------------MFTGFVCVQGsFDSLLQLPQsRLSARTRLRSK-RVFFVSDFGAIGDGAANDTQ------AF 54 
297839921   1 MSYSCGTTVVVTLLLLVVASSLALTANADsFESLLQLPR-RQSRSTRPRSE-RLLHVGKFGAKGNGFTDDTK------AF 72 
18412685   73 ADAWKTACSSKVKTRILVPENYTCLLRPIDLSGPCKARLTLQISGTIIAPNDPDVWEGLNRRKWLYFHGLSRLTVEGGGT 152
224058683  78 KEAWEMACSFRGRTRIVIPAGYNFLVHPVDFGGPCKSKVTLDISGTIVAPEDPAAWKGLNHRKWLYFHGVKHLTVEGGGT 157
225442879  65 RNAWKIACASITKASIVIPHDKKFLVRPISFGGPCRAKVTVTISGTIIAPKDPDVWHGLNPQKWLYFHGVNHLTVRGSGI 144
255553121  55 KEAWEMACSFPSRTRIVIPAGYTLLVHPVDLGGPCKSKLTLIISGTIVAPKDPAFWKGSNPRKWLYFHGVNHLTIDGGGT 134
297839921  73 ADAWKTACSSKVKTRILVPENYTCLLRPIDLSGPCKARLTLQISGTIIAPNDPDAWEGLNRRKWLYFHGLSRLTVEGGGT 152
18412685  153 VNGMGQEWWERSCKHNHSNPCRGAPTALTFHKCKNMRVENLNVIDSQQMHIALTSCRRVTISGLKVIAPATSPNTDGIHI 232
224058683 158 VNGRGWLWWAQSCKINKTNPCRNAPTAITFHKCKDLKVENLKVVCGQKMHVAFTNCLRVMTFNLIVTSPAVSPNTDGIHI 237
225442879 145 INGRGHKWWSQSCKINATNPCEHAPTAIIFHRCKKLRVRDIALINSQRTHIAFTNSFRIVVSGIKMIAPASSPNTDGLHI 224
255553121 135 INGMGHRWWAQSCKINPNNPCRHAPTAMTFHKCKDLKIMNLRVVYGQQMHLSFTNCIRVTAFHLVVTSPAFSPNTDGIHI 214
297839921 153 VNGMGQEWWTRSCKHNHSNPCRGAPTAITFHKCKNMRVENLNVIDSQQMHIAFTSCRRVAISGLKVIAPATSPNTDGIHI 232
18412685  233 SVSRGIVIDNTTVSTGDDCISIVKNSTQISISNIICGPGHGISIGSLGKSKSWEEVRDITVDTAIISDTANGVRIKTWQG 312
224058683 238 SASHGVKIKDSVVRTGDDCISIVSNSSRIKIRNIACGPGHGISIGSLGKSNSSSLVRDVMVDGAFLSNTDNGVRIKTWQG 317
225442879 225 SSSSRVNIKDSIIRTGDDCISIVGNSSIIRIKNIACGPGHGISVGSLGMGNSWAQVHDVIVDQAFLAHTKNGLRIKTWQG 304
255553121 215 SASRHVEIRDSIVRTGDDCISIVGNSSRIKIRKIACGPGHGISIGSLGKYDSSSKVHDILIDGAFLSNTDNGLRIKTWQG 294
297839921 233 SVSRGIVIDNTTVSTGDDCVSIVKNSSQISISNIICGPGHGISIGSLGKSESWEEVRDITVDTAFISDTANGVRIKTWQG 312
18412685  313 GSGLVSKIIFRNIKMNNVSNPIIIDQYYCDSRKPCANQTSAISIENISFVHVRGTSASKEAIKISCSDSSPCRNILLQDI 392
224058683 318 GGGNATNITFQNIFMENVSNPIIIDQYYCDAHVPCANQTSAVKVENISFRRIKGTSATEEAIKFACSDDLPCKGLYLEDV 397
225442879 305 GRGFASQITFQNVLMENVSHPIIIDQYYCDSLTPCLNQTLAVKVANISYVSIKGTSATEESVRFACSDSFPCEKLYLEEV 384
255553121 295 GSGNATEIKFQNVFMKNVSNPIIIDQYYCDSQIPCANQSSAVKVANISFIHIKGTSATEHAIRFACSDSSPCEGLYLEDV 374
297839921 313 GSGLVSKIIFRNIKMNNVSNPIIIDQYYCDSRKPCANQTSALSVENISFVYVRGTSATKQAIKISCSDSSPCRNILLQDV 392
18412685  393 DLEPSNGDgFTESFCWEAYGSSSGQVYPPPCLSDDTSFLEQSVQSGITSAY 443
224058683 398 QLLSLTGG-TTRSFCWQAYGSSRGLVHPSPCFSCSEGFIKEKVPSHLLQFF 447
225442879 385 QLLSYTGK-NTSSFCWEAQGLTSGSVDPPACFSSNGTFIGQKADSGSALQS 434
255553121 375 QLLSHNGE-ILKSFCWEAYGSSVDPVNPPPCFSYSQSFIKQKVQSESFTFF 424
297839921 393 DLEPSSGDgFTESFCWEAYGSSSGQVYPPPCLSDDTSFLEQSVQSGITSAY 443
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap